FG538769
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of FG538769 vs. TrEMBL
Match: C6SVN6_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1) HSP 1 Score: 64.6994 bits (156), Expect = 3.482e-9 Identity = 29/42 (69.05%), Postives = 34/42 (80.95%), Query Frame = 1 Query: 1 PAMVQSPHQSCSHAPGLSMKRSLQRFLQKRKNRIQQASPYNH 126 P ++QSPH S GLSMKRSLQRFLQKRKNR+Q+ SPY+H Sbjct: 94 PILLQSPHNMYSPGTGLSMKRSLQRFLQKRKNRVQETSPYHH 135
BLAST of FG538769 vs. TrEMBL
Match: C6T1G4_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1) HSP 1 Score: 60.8474 bits (146), Expect = 5.027e-8 Identity = 28/42 (66.67%), Postives = 36/42 (85.71%), Query Frame = 1 Query: 1 PAMVQSPHQSCSHAPGLSMKRSLQRFLQKRKNRIQQASPYNH 126 PA++QS +Q S GLSM++SLQRFLQKRKNR+Q+ASPY+H Sbjct: 97 PAVMQSNNQLYSPGTGLSMRKSLQRFLQKRKNRVQEASPYHH 138
BLAST of FG538769 vs. TrEMBL
Match: C6SVN6_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1) HSP 1 Score: 64.6994 bits (156), Expect = 4.354e-9 Identity = 29/42 (69.05%), Postives = 34/42 (80.95%), Query Frame = 1 Query: 1 PAMVQSPHQSCSHAPGLSMKRSLQRFLQKRKNRIQQASPYNH 126 P ++QSPH S GLSMKRSLQRFLQKRKNR+Q+ SPY+H Sbjct: 94 PILLQSPHNMYSPGTGLSMKRSLQRFLQKRKNRVQETSPYHH 135
BLAST of FG538769 vs. TrEMBL
Match: C6T1G4_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1) HSP 1 Score: 60.8474 bits (146), Expect = 6.286e-8 Identity = 28/42 (66.67%), Postives = 36/42 (85.71%), Query Frame = 1 Query: 1 PAMVQSPHQSCSHAPGLSMKRSLQRFLQKRKNRIQQASPYNH 126 PA++QS +Q S GLSM++SLQRFLQKRKNR+Q+ASPY+H Sbjct: 97 PAVMQSNNQLYSPGTGLSMRKSLQRFLQKRKNRVQEASPYHH 138
BLAST of FG538769 vs. Soybean peptides
Match: Glyma08g10220.1|PACid:16270629 () HSP 1 Score: 64.6994 bits (156), Expect = 3.120e-11 Identity = 29/42 (69.05%), Postives = 34/42 (80.95%), Query Frame = 1 Query: 1 PAMVQSPHQSCSHAPGLSMKRSLQRFLQKRKNRIQQASPYNH 126 P ++QSPH S GLSMKRSLQRFLQKRKNR+Q+ SPY+H Sbjct: 94 PILLQSPHNMYSPGTGLSMKRSLQRFLQKRKNRVQETSPYHH 135
BLAST of FG538769 vs. Soybean peptides
Match: Glyma05g27280.1|PACid:16259802 () HSP 1 Score: 61.6178 bits (148), Expect = 2.641e-10 Identity = 29/43 (67.44%), Postives = 36/43 (83.72%), Query Frame = 1 Query: 1 PAMVQSPHQSC-SHAPGLSMKRSLQRFLQKRKNRIQQASPYNH 126 P ++QSPH + S + GLSMKRSLQRFLQKRKNR+Q+ SPY+H Sbjct: 92 PILLQSPHNNMYSPSTGLSMKRSLQRFLQKRKNRVQETSPYHH 134
BLAST of FG538769 vs. Soybean peptides
Match: Glyma13g29070.1|PACid:16291947 () HSP 1 Score: 60.8474 bits (146), Expect = 4.505e-10 Identity = 28/42 (66.67%), Postives = 36/42 (85.71%), Query Frame = 1 Query: 1 PAMVQSPHQSCSHAPGLSMKRSLQRFLQKRKNRIQQASPYNH 126 PA++QS +Q S GLSM++SLQRFLQKRKNR+Q+ASPY+H Sbjct: 97 PAVMQSNNQLYSPGTGLSMRKSLQRFLQKRKNRVQEASPYHH 138
BLAST of FG538769 vs. Soybean peptides
Match: Glyma15g09980.1|PACid:16298259 () HSP 1 Score: 55.0694 bits (131), Expect = 2.472e-8 Identity = 25/42 (59.52%), Postives = 33/42 (78.57%), Query Frame = 1 Query: 1 PAMVQSPHQSCSHAPGLSMKRSLQRFLQKRKNRIQQASPYNH 126 P ++QS +Q S G SM++SLQRFLQKR+NR+Q+ASPY H Sbjct: 92 PTVMQSNNQLYSPGTGPSMRKSLQRFLQKRRNRVQEASPYRH 133
BLAST of FG538769 vs. Medicago proteins
Match: IMGA|Medtr2g019190.1 (Protein TIFY 5A (AHRD V1 ***- Q8LBM2); contains Interpro domain(s) IPR018467 CCT domain-like chr02_pseudomolecule_IMGAG_V3.5 6167409-6165875 E EGN_Mt100125 20100825) HSP 1 Score: 68.1662 bits (165), Expect = 1.712e-12 Identity = 32/40 (80.00%), Postives = 35/40 (87.50%), Query Frame = 1 Query: 7 MVQSPHQSCSHAPGLSMKRSLQRFLQKRKNRIQQASPYNH 126 +VQSPHQ S PGLSMKRSLQRFLQKRKNR+Q+ASPY H Sbjct: 39 IVQSPHQLYSPGPGLSMKRSLQRFLQKRKNRVQEASPYYH 78 The following BLAST results are available for this feature:
BLAST of FG538769 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Trembl) Total hits: 2
BLAST of FG538769 vs. TrEMBL
Analysis Date: 2011-04-27 (Homology Analysis: Pisum sativum unigene v2 vs Trembl) Total hits: 2
BLAST of FG538769 vs. Soybean peptides
Analysis Date: 2011-04-21 (Homology Analysis: Pisum sativum unigene v2 vs Soybean peptides) Total hits: 4
BLAST of FG538769 vs. Medicago proteins
Analysis Date: 2011-04-21 (Homology Analysis: Pisum sativum unigene v2 vs Medicago proteins) Total hits: 1
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >FG538769 ID=FG538769; Name=FG538769; organism=Pisum sativum; type=EST; length=424bpback to top |