AW566009
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of AW566009 vs. TrEMBL
Match: A5ALT6_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VITISV_041807 PE=4 SV=1) HSP 1 Score: 68.9366 bits (167), Expect = 2.518e-10 Identity = 34/60 (56.67%), Postives = 40/60 (66.67%), Query Frame = 3 Query: 6 LESLDIRQCFNINFIVSLAKRCKEQIKYLLLPNDDTDDYPFET---------EDYPEGLS 158 LESLD+RQCFN+N +LAKRC EQIK L PND TDDY F+ E+YP G+S Sbjct: 225 LESLDLRQCFNVNLGGNLAKRCAEQIKILRYPNDSTDDYEFDAEIHDDASFDEEYPSGIS 284
BLAST of AW566009 vs. TrEMBL
Match: Q9SY41_ARATH (Putative nodulin OS=Arabidopsis thaliana GN=AT4g03630 PE=2 SV=1) HSP 1 Score: 60.8474 bits (146), Expect = 6.857e-8 Identity = 27/43 (62.79%), Postives = 32/43 (74.42%), Query Frame = 3 Query: 6 LESLDIRQCFNINFIVSLAKRCKEQIKYLLLPNDDTDDYPFET 134 LE LD+RQCFNIN + L KRC E+IK L PND T DYP++T Sbjct: 171 LEHLDLRQCFNINLVGDLEKRCMERIKDLRRPNDSTADYPYDT 213
BLAST of AW566009 vs. TrEMBL
Match: B9SKT5_RICCO (Ubiquitin-protein ligase, putative OS=Ricinus communis GN=RCOM_1091170 PE=4 SV=1) HSP 1 Score: 56.9954 bits (136), Expect = 9.901e-7 Identity = 31/66 (46.97%), Postives = 36/66 (54.55%), Query Frame = 3 Query: 6 LESLDIRQCFNINFIVSLAKRCKEQIKYLLLPNDDTDDYPF---------ETEDYPEGLSIWGFQT 176 LE LD+RQCFN++ L C E+IK L P+D TDDYPF EDYP G S F T Sbjct: 224 LEFLDLRQCFNVHLEGELGMLCGERIKDLRRPDDPTDDYPFNPEIPDYGSSEEDYPSGFSDMEFAT 289
BLAST of AW566009 vs. SwissProt
Match: FB221_ARATH (Putative F-box protein At4g05480 OS=Arabidopsis thaliana GN=At4g05480 PE=4 SV=1) HSP 1 Score: 53.9138 bits (128), Expect = 6.277e-7 Identity = 23/40 (57.50%), Postives = 30/40 (75.00%), Query Frame = 3 Query: 9 ESLDIRQCFNINFIVSLAKRCKEQIKYLLLPNDDTDDYPF 128 E LD+R+CFNIN + +L KRC ++IK L P+D T DYPF Sbjct: 253 EHLDVRKCFNINLVGNLEKRCMKRIKELRRPHDSTADYPF 292
BLAST of AW566009 vs. TAIR peptide
Match: AT4G03630.1 (| Symbols: | RNI-like superfamily protein | chr4:1608750-1610037 FORWARD LENGTH=220) HSP 1 Score: 60.8474 bits (146), Expect = 5.498e-10 Identity = 27/43 (62.79%), Postives = 32/43 (74.42%), Query Frame = 3 Query: 6 LESLDIRQCFNINFIVSLAKRCKEQIKYLLLPNDDTDDYPFET 134 LE LD+RQCFNIN + L KRC E+IK L PND T DYP++T Sbjct: 171 LEHLDLRQCFNINLVGDLEKRCMERIKDLRRPNDSTADYPYDT 213
BLAST of AW566009 vs. TAIR peptide
Match: AT4G05475.1 (| Symbols: | RNI-like superfamily protein | chr4:2765962-2767957 REVERSE LENGTH=309) HSP 1 Score: 52.7582 bits (125), Expect = 1.497e-7 Identity = 22/40 (55.00%), Postives = 30/40 (75.00%), Query Frame = 3 Query: 9 ESLDIRQCFNINFIVSLAKRCKEQIKYLLLPNDDTDDYPF 128 E LD+R+CFNIN + +L KRC ++IK L P+D T DYP+ Sbjct: 253 EHLDVRKCFNINLVGNLEKRCMKRIKELRRPHDSTADYPY 292
BLAST of AW566009 vs. TAIR peptide
Match: AT4G05470.1 (| Symbols: | RNI-like superfamily protein | chr4:2763256-2765351 REVERSE LENGTH=304) HSP 1 Score: 50.447 bits (119), Expect = 7.431e-7 Identity = 22/41 (53.66%), Postives = 28/41 (68.29%), Query Frame = 3 Query: 6 LESLDIRQCFNINFIVSLAKRCKEQIKYLLLPNDDTDDYPF 128 LE LD+R+CF I+ + +L KRC E IK L P D T DYP+ Sbjct: 261 LEHLDVRKCFRISLVGNLEKRCLEMIKELRRPGDSTADYPY 301
BLAST of AW566009 vs. TAIR peptide
Match: AT4G03630.1 (| Symbols: | RNI-like superfamily protein | chr4:1608750-1610037 FORWARD LENGTH=220) HSP 1 Score: 60.8474 bits (146), Expect = 5.498e-10 Identity = 27/43 (62.79%), Postives = 32/43 (74.42%), Query Frame = 3 Query: 6 LESLDIRQCFNINFIVSLAKRCKEQIKYLLLPNDDTDDYPFET 134 LE LD+RQCFNIN + L KRC E+IK L PND T DYP++T Sbjct: 171 LEHLDLRQCFNINLVGDLEKRCMERIKDLRRPNDSTADYPYDT 213
BLAST of AW566009 vs. TAIR peptide
Match: AT4G05475.1 (| Symbols: | RNI-like superfamily protein | chr4:2765962-2767957 REVERSE LENGTH=309) HSP 1 Score: 52.7582 bits (125), Expect = 1.497e-7 Identity = 22/40 (55.00%), Postives = 30/40 (75.00%), Query Frame = 3 Query: 9 ESLDIRQCFNINFIVSLAKRCKEQIKYLLLPNDDTDDYPF 128 E LD+R+CFNIN + +L KRC ++IK L P+D T DYP+ Sbjct: 253 EHLDVRKCFNINLVGNLEKRCMKRIKELRRPHDSTADYPY 292
BLAST of AW566009 vs. TAIR peptide
Match: AT4G05470.1 (| Symbols: | RNI-like superfamily protein | chr4:2763256-2765351 REVERSE LENGTH=304) HSP 1 Score: 50.447 bits (119), Expect = 7.431e-7 Identity = 22/41 (53.66%), Postives = 28/41 (68.29%), Query Frame = 3 Query: 6 LESLDIRQCFNINFIVSLAKRCKEQIKYLLLPNDDTDDYPF 128 LE LD+R+CF I+ + +L KRC E IK L P D T DYP+ Sbjct: 261 LEHLDVRKCFRISLVGNLEKRCLEMIKELRRPGDSTADYPY 301
BLAST of AW566009 vs. TrEMBL
Match: A5ALT6_VITVI (Whole genome shotgun sequence of line PN40024, scaffold_3.assembly12x OS=Vitis vinifera GN=VITISV_041807 PE=4 SV=1) HSP 1 Score: 68.9366 bits (167), Expect = 3.077e-10 Identity = 34/60 (56.67%), Postives = 40/60 (66.67%), Query Frame = 3 Query: 6 LESLDIRQCFNINFIVSLAKRCKEQIKYLLLPNDDTDDYPFET---------EDYPEGLS 158 LESLD+RQCFN+N +LAKRC EQIK L PND TDDY F+ E+YP G+S Sbjct: 225 LESLDLRQCFNVNLGGNLAKRCAEQIKILRYPNDSTDDYEFDAEIHDDASFDEEYPSGIS 284
BLAST of AW566009 vs. TrEMBL
Match: Q9SY41_ARATH (Putative nodulin OS=Arabidopsis thaliana GN=AT4g03630 PE=2 SV=1) HSP 1 Score: 60.8474 bits (146), Expect = 8.380e-8 Identity = 27/43 (62.79%), Postives = 32/43 (74.42%), Query Frame = 3 Query: 6 LESLDIRQCFNINFIVSLAKRCKEQIKYLLLPNDDTDDYPFET 134 LE LD+RQCFNIN + L KRC E+IK L PND T DYP++T Sbjct: 171 LEHLDLRQCFNINLVGDLEKRCMERIKDLRRPNDSTADYPYDT 213
BLAST of AW566009 vs. Lotus protein
Match: chr6.CM0118.80.r2.m (- phase: 0 ) HSP 1 Score: 72.7886 bits (177), Expect = 8.187e-14 Identity = 36/59 (61.02%), Postives = 39/59 (66.10%), Query Frame = 3 Query: 6 LESLDIRQCFNINFIVSLAKRCKEQIKYLLLPNDDTDDYPFET--------EDYPEGLS 158 LE+LD+RQCFN+N SL KRC EQIK L LPND DDYPFE EDYP G S Sbjct: 223 LETLDLRQCFNVNLAGSLGKRCAEQIKDLRLPNDPADDYPFEAEIDYGSLDEDYPSGFS 281
BLAST of AW566009 vs. Soybean peptides
Match: Glyma13g29200.1|PACid:16291966 () HSP 1 Score: 73.559 bits (179), Expect = 1.229e-13 Identity = 37/59 (62.71%), Postives = 40/59 (67.80%), Query Frame = 3 Query: 6 LESLDIRQCFNINFIVSLAKRCKEQIKYLLLPNDDTDDYPFET--------EDYPEGLS 158 LESLD+RQCFN+N SL KRC EQIK L LP D TDDYPFE EDYP G+S Sbjct: 218 LESLDLRQCFNVNLAGSLGKRCAEQIKELRLPCDPTDDYPFEAEIDYGSLDEDYPSGIS 276
BLAST of AW566009 vs. Soybean peptides
Match: Glyma15g09890.1|PACid:16298248 () HSP 1 Score: 64.3142 bits (155), Expect = 3.224e-11 Identity = 32/47 (68.09%), Postives = 35/47 (74.47%), Query Frame = 3 Query: 6 LESLDIRQCFNINFIVSLAKRCKEQIKYLLLPNDDTDDYPFETE-DY 143 LESLD+RQCFN+N SL KRC EQIK L LP D TDD PFE + DY Sbjct: 226 LESLDLRQCFNVNLAGSLGKRCAEQIKELRLPCDPTDDCPFEADVDY 272 HSP 2 Score: 21.1718 bits (43), Expect = 3.224e-11 Identity = 8/16 (50.00%), Postives = 13/16 (81.25%), Query Frame = 2 Query: 221 GSEFSEFEFDG--NYY 262 GS+FS+++FD +YY Sbjct: 301 GSDFSDYDFDSDPDYY 316
BLAST of AW566009 vs. SwissProt
Match: FB221_ARATH (Putative F-box protein At4g05475 OS=Arabidopsis thaliana GN=At4g05475 PE=4 SV=1) HSP 1 Score: 53.9138 bits (128), Expect = 6.391e-7 Identity = 23/40 (57.50%), Postives = 30/40 (75.00%), Query Frame = 3 Query: 9 ESLDIRQCFNINFIVSLAKRCKEQIKYLLLPNDDTDDYPF 128 E LD+R+CFNIN + +L KRC ++IK L P+D T DYPF Sbjct: 253 EHLDVRKCFNINLVGNLEKRCMKRIKELRRPHDSTADYPF 292
BLAST of AW566009 vs. Medicago proteins
Match: IMGA|Medtr2g018940.1 (F-box protein SKIP19 (AHRD V1 ***- Q9M0U9); contains Interpro domain(s) IPR001810 Cyclin-like F-box chr02_pseudomolecule_IMGAG_V3.5 5992804-5995771 E EGN_Mt100125 20100825) HSP 1 Score: 72.4034 bits (176), Expect = 7.428e-15 Identity = 38/67 (56.72%), Postives = 42/67 (62.69%), Query Frame = 3 Query: 6 LESLDIRQCFNINFIVSLAKRCKEQIKYLLLPNDDTDDYPF----------------ETEDYPEGLS 158 LESLDIRQCFN++ SL KRC+EQIKYL LP D TDDYPF E EDYP G+S Sbjct: 230 LESLDIRQCFNLSLRGSLGKRCREQIKYLRLPYDATDDYPFRVELHYGYGSHDEDEDEDEDYPSGIS 296 HSP 2 Score: 24.6386 bits (52), Expect = 7.428e-15 Identity = 10/16 (62.50%), Postives = 14/16 (87.50%), Query Frame = 2 Query: 221 GSEFSEFEFDGNY-YD 265 GSEFSE+++D +Y YD Sbjct: 314 GSEFSEYDYDDDYDYD 329
BLAST of AW566009 vs. Medicago proteins
Match: IMGA|Medtr2g018950.1 (F-box protein SKIP19 (AHRD V1 ***- Q9M0U9); contains Interpro domain(s) IPR001810 Cyclin-like F-box chr02_pseudomolecule_IMGAG_V3.5 5999488-6001776 E EGN_Mt100125 20100825) HSP 1 Score: 73.559 bits (179), Expect = 7.147e-14 Identity = 32/49 (65.31%), Postives = 39/49 (79.59%), Query Frame = 3 Query: 6 LESLDIRQCFNINFIVSLAKRCKEQIKYLLLPNDDTDDYPFETEDYPEG 152 LESLDIR+CFN+N + +L KRCKEQIKY LP+D TDDYPF+T + G Sbjct: 237 LESLDIRRCFNVNLVGTLGKRCKEQIKYFRLPHDATDDYPFQTSECDYG 285
BLAST of AW566009 vs. Medicago proteins
Match: IMGA|Medtr2g018930.1 (DNA-directed RNA polymerase subunit beta'' (AHRD V1 *--- Q8HVY3) chr02_pseudomolecule_IMGAG_V3.5 5990879-5992532 E EGN_Mt100125 20100825) HSP 1 Score: 67.781 bits (164), Expect = 8.321e-13 Identity = 35/62 (56.45%), Postives = 41/62 (66.13%), Query Frame = 3 Query: 6 LESLDIRQCFNINFIVSLAKRCKEQIKYLLLPNDDTDDYPF-----------ETEDYPEGLS 158 LESLDIRQCFN++ SL K+C+EQIK L LP D T+DYPF E EDYP G+S Sbjct: 50 LESLDIRQCFNLSLRGSLGKKCREQIKDLRLPYDATEDYPFQVIAYDYGSPDEDEDYPSGIS 111 HSP 2 Score: 22.3274 bits (46), Expect = 8.321e-13 Identity = 8/12 (66.67%), Postives = 11/12 (91.67%), Query Frame = 2 Query: 221 GSEFSEFEFDGN 256 GSEFSE++ DG+ Sbjct: 128 GSEFSEYDSDGS 139
BLAST of AW566009 vs. Medicago proteins
Match: IMGA|Medtr2g019060.1 (F-box protein SKIP19 (AHRD V1 ***- Q9M0U9); contains Interpro domain(s) IPR006553 Leucine-rich repeat, cysteine-containing subtype chr02_pseudomolecule_IMGAG_V3.5 6081424-6078750 E EGN_Mt100125 20100825) HSP 1 Score: 63.5438 bits (153), Expect = 7.396e-11 Identity = 31/44 (70.45%), Postives = 35/44 (79.55%), Query Frame = 3 Query: 6 LESLDIRQCFNINF--IVSLAKRCKEQIKYLLLPNDDTDDYPFE 131 LESLDIRQCFNINF + S+ KR EQ+KYL LP D TDDYPF+ Sbjct: 216 LESLDIRQCFNINFNLVASVGKRFIEQVKYLRLPYDATDDYPFQ 259
BLAST of AW566009 vs. Medicago proteins
Match: IMGA|Medtr2g018970.1 (F-box protein SKIP19 (AHRD V1 ***- Q9M0U9) chr02_pseudomolecule_IMGAG_V3.5 6007897-6008715 E EGN_Mt100125 20100825) HSP 1 Score: 62.003 bits (149), Expect = 2.152e-10 Identity = 33/59 (55.93%), Postives = 38/59 (64.41%), Query Frame = 3 Query: 6 LESLDIRQCFNINFIVSLAKRCKEQIKYLLLPNDDTDDYPFET--------EDYPEGLS 158 LESLDI N+N I KRCKEQIKYLLLP D +DDY F+ EDYP+G+S Sbjct: 45 LESLDICLRLNVNLIGISEKRCKEQIKYLLLPYDPSDDYSFQAECDYGSPDEDYPDGIS 103 The following BLAST results are available for this feature:
BLAST of AW566009 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Trembl) Total hits: 3
BLAST of AW566009 vs. SwissProt
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Swissprot) Total hits: 1
BLAST of AW566009 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Pisum sativum unigene v1 vs TAIR 10 peptide) Total hits: 3
BLAST of AW566009 vs. TAIR peptide
Analysis Date: 2011-04-21 (Homology Analysis: Pisum sativum unigene v2 vs TAIR 10 peptide) Total hits: 3
BLAST of AW566009 vs. TrEMBL
Analysis Date: 2011-04-27 (Homology Analysis: Pisum sativum unigene v2 vs Trembl) Total hits: 2
BLAST of AW566009 vs. Lotus protein
Analysis Date: 2011-04-21 (Homology Analysis: Pisum sativum unigene v2 vs Lotus proteins) Total hits: 1
BLAST of AW566009 vs. Soybean peptides
Analysis Date: 2011-04-21 (Homology Analysis: Pisum sativum unigene v2 vs Soybean peptides) Total hits: 2
BLAST of AW566009 vs. SwissProt
Analysis Date: 2011-04-21 (Homology Analysis: Pisum sativum unigene v2 vs Swissprot) Total hits: 1
BLAST of AW566009 vs. Medicago proteins
Analysis Date: 2011-04-21 (Homology Analysis: Pisum sativum unigene v2 vs Medicago proteins) Total hits: 5
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >AW566009 ID=AW566009; Name=AW566009; organism=Pisum sativum; type=EST; length=560bpback to top |