CD858796

EST Overview
NameCD858796
Unique NameCD858796
TypeEST
OrganismPisum sativum (pea)
Sequence length385
Libraries
Library NameType
LIBEST_013997 CIcdna_library
Unigenes
This EST is part of the following unigenes:
Unigene NameAnalysis NameSequence type in Unigene
Pisum sativum unigene v2Pisum sativum unigene v2EST
Pisum sativum unigene v1Pisum sativum unigene v1EST
Homology
BLAST of CD858796 vs. TrEMBL
Match: C6TJV0_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 7.992e-14
Identity = 55/123 (44.72%), Postives = 65/123 (52.85%), Query Frame = 3
Query:    9 RKRDQQLLNLKDILNKVIRERDEAHEKCXXXXXXXXXXXXXXXXXXXXXXXPLSGISSVEDEQQQHKRGIESCNNNGLXXXXXXXXXXXXXPPTATEQQQQPMMMIELIAKDKPLPEKGKLLQ 377
            +KRD+QLLNLKD+L+K IRERDEA EKC                       P+SGISS+EDE    +RGI+S N + L                  + Q Q   MIEL   DKPLPEKGKLLQ
Sbjct:    8 KKRDEQLLNLKDLLSKTIRERDEAQEKC-----QRLLLEKLVFQQQQQQAAPVSGISSIEDEP---RRGIDSNNGHSLSDCEESIVSSPVI-DHLPQPQPQTQSMIEL-TPDKPLPEKGKLLQ 120          
BLAST of CD858796 vs. TrEMBL
Match: Q9FFB5_ARATH (Emb|CAB89309.1 OS=Arabidopsis thaliana GN=At5g22930 PE=4 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 1.507e-12
Identity = 49/128 (38.28%), Postives = 66/128 (51.56%), Query Frame = 3
Query:    3 ELRKRDQQLLNLKDILNKVIRERDEAHEKCXXXXXXXXXXXXXXXXXXXXXXXPLSGISSVEDEQ---QQHKRGIESCNNNGLXXXXXXXXXXXXXPPTATEQQQQPMMMIELIAKDKPLPEKGKLLQ 377
            E+RKRD+QL++LKDIL K I+ERDEA EKC                       PLSG SS+EDEQ   QQ +      +++               PP   E+     ++++ + +DKPLPEKGKLLQ
Sbjct:   54 EIRKRDEQLIHLKDILTKTIKERDEALEKC-----QRLMFDSHSLQQQKHMTPPLSGASSIEDEQVQPQQLRSNKSFSSSDCEESIMSPTDHIMNPPPCQLEEVSGTEIIMDPLLQDKPLPEKGKLLQ 176          
BLAST of CD858796 vs. TrEMBL
Match: B9HQN8_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_558314 PE=4 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 1.968e-12
Identity = 55/133 (41.35%), Postives = 63/133 (47.37%), Query Frame = 3
Query:    3 ELRKRDQQLLNLKDILNKVIRERDEAHEKCXXXXXXXXXXXXXXXXXXXXXXXPLSGISSVEDEQQQHKRGIESCNNNGLXXXXXXXXXXXXXPPTATEQQQQ--------PMMMIELIAKDKPLPEKGKLLQ 377
            ELRK+D QL +LKD+L K IRERDEA EKC                       PLSGISS+EDE    +RGI+S N                  PT    Q          P   IEL+  +KPLPEKGKLLQ
Sbjct:   44 ELRKKDDQLFHLKDLLIKAIRERDEAQEKC---QRLVTEKVLLQQQPQHHQNAPLSGISSIEDEP---RRGIDSSNGFSSSDCEESIVSSPVIDPTPQPSQLPPPAAPQTIPQAAIELV-PEKPLPEKGKLLQ 169          
BLAST of CD858796 vs. TrEMBL
Match: D7M1L0_ARALY (Putative uncharacterized protein OS=Arabidopsis lyrata subsp. lyrata GN=ARALYDRAFT_351315 PE=4 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 1.666e-11
Identity = 48/128 (37.50%), Postives = 64/128 (50.00%), Query Frame = 3
Query:    3 ELRKRDQQLLNLKDILNKVIRERDEAHEKCXXXXXXXXXXXXXXXXXXXXXXXPLSGISSVEDEQ---QQHKRGIESCNNNGLXXXXXXXXXXXXXPPTATEQQQQPMMMIELIAKDKPLPEKGKLLQ 377
            E+RKRD+QL++LKDI+ K I+ERDEA EKC                       PLSG SS+EDEQ   QQ        +++               PP+  E+     + ++ +  DKPLPEKGKLLQ
Sbjct:   44 EIRKRDEQLIHLKDIITKTIKERDEALEKC-----QRLMFDNHSLQQQKHMTPPLSGASSIEDEQVQPQQLGSNKSFSSSDCEESIMSPTDHVMNPPPSQLEEVSGTEITMDPLFPDKPLPEKGKLLQ 166          
BLAST of CD858796 vs. TrEMBL
Match: B9N869_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_786100 PE=4 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 2.842e-11
Identity = 52/133 (39.10%), Postives = 64/133 (48.12%), Query Frame = 3
Query:    3 ELRKRDQQLLNLKDILNKVIRERDEAHEKCXXXXXXXXXXXXXXXXXXXXXXXPLSGISSVEDEQQQHKRGIES--------CNNNGLXXXXXXXXXXXXXPPTATEQQQQPMMMIELIAKDKPLPEKGKLLQ 377
            ELRK+D QL +LKD+L+K IRERD+A EK                        PLSGISS+EDE    +RGI+S        C  + +              P     Q  P   IEL+  +KPLPEKGKLLQ
Sbjct:   25 ELRKKDDQLFHLKDLLSKAIRERDDAQEK----WKRLAIEKVLLQQQQHHQNAPLSGISSIEDEP---RRGIDSSNGFSSSDCEESIVSSPVIDQTPQPSQLPQTAAPQTIPQAAIELV-PEKPLPEKGKLLQ 149          
BLAST of CD858796 vs. TrEMBL
Match: B9SCJ6_RICCO (Putative uncharacterized protein OS=Ricinus communis GN=RCOM_0474610 PE=4 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 3.712e-11
Identity = 53/133 (39.85%), Postives = 63/133 (47.37%), Query Frame = 3
Query:    3 ELRKRDQQLLNLKDILNKVIRERDEAHEKCXXXXXXXXXXXXXXXXXXXXXXXPLSGISSVEDEQQQHKRGIESCN-------NNGLXXXXXXXXXXXXXPPTA-TEQQQQPMMMIELIAKDKPLPEKGKLLQ 377
            ELRKRD QL+ LKD+L+K+IRERDEA EKC                       PLSGISS+EDE    +R I+S N          +             PPTA +     P      +   KPLPEKGKLLQ
Sbjct:   44 ELRKRDDQLIQLKDLLSKMIRERDEAIEKC----QRLLLEKLLLQQQQQQQNAPLSGISSIEDEP---RRAIDSNNGFSSSDCEESIVSSPVIDQIPPQLPPTAPSSSVVAPQGTTLEMVPQKPLPEKGKLLQ 169          
BLAST of CD858796 vs. TrEMBL
Match: D7LNJ4_ARALY (Putative uncharacterized protein OS=Arabidopsis lyrata subsp. lyrata GN=ARALYDRAFT_484892 PE=4 SV=1)

HSP 1 Score: 63.5438 bits (153), Expect = 7.741e-9
Identity = 48/131 (36.64%), Postives = 64/131 (48.85%), Query Frame = 3
Query:    3 ELRKRDQQLLNLKDILNKVIRERDEAHEKC--XXXXXXXXXXXXXXXXXXXXXXXPLSGISS-VEDEQQQHKRGIESCNNNGLXXXXXXXXXXXXXPPTATEQQQQPMMMIELIA---KDKPLPEKGKLLQ 377
            ELRKRD+QL++L+D+L K ++ERD+A EKC                         PLSG SS +EDEQ Q ++   + N +                   T  QQ  +   EL+A    +KPLPEKGKLLQ
Sbjct:   43 ELRKRDEQLIHLEDVLTKTLKERDDALEKCHHLLLNNLLLQQKQQQNQKQELITPPLSGASSIIEDEQVQPQQPQLNSNKSFSSSDTEESIMSPSVIDPVTMNQQIEVSGDELMATLLPEKPLPEKGKLLQ 173          
BLAST of CD858796 vs. TrEMBL
Match: Q9LXI1_ARATH (Putative uncharacterized protein F14D17_10 OS=Arabidopsis thaliana GN=F14D17_10 PE=4 SV=1)

HSP 1 Score: 61.2326 bits (147), Expect = 3.842e-8
Identity = 48/133 (36.09%), Postives = 63/133 (47.37%), Query Frame = 3
Query:    3 ELRKRDQQLLNLKDILNKVIRERDEAHEK----CXXXXXXXXXXXXXXXXXXXXXXXPLSGISS-VEDEQQQHKRGIESCNNNGLXXXXXXXXXXXXXPPTATEQQQQPMMMIELIA---KDKPLPEKGKLLQ 377
            ELRKRD+QL++L+D+L K ++ERDEA EK                            PLSG SS +EDEQ Q ++   + N +                   T  QQ  +   E++A    DKPLPEKGKLLQ
Sbjct:   13 ELRKRDEQLIHLEDVLTKTLKERDEALEKYNHLLLNNLLLQQKQQQNQNQKQELVTPPLSGASSIIEDEQVQPQQPQLNSNKSFSSSDTEESIMSPSVIDPVTMNQQIEVSGDEMLATLLPDKPLPEKGKLLQ 145          
BLAST of CD858796 vs. TrEMBL
Match: Q84JJ0_ARATH (Putative uncharacterized protein At3g44940 OS=Arabidopsis thaliana GN=At3g44940 PE=2 SV=1)

HSP 1 Score: 61.2326 bits (147), Expect = 3.842e-8
Identity = 48/133 (36.09%), Postives = 63/133 (47.37%), Query Frame = 3
Query:    3 ELRKRDQQLLNLKDILNKVIRERDEAHEK----CXXXXXXXXXXXXXXXXXXXXXXXPLSGISS-VEDEQQQHKRGIESCNNNGLXXXXXXXXXXXXXPPTATEQQQQPMMMIELIA---KDKPLPEKGKLLQ 377
            ELRKRD+QL++L+D+L K ++ERDEA EK                            PLSG SS +EDEQ Q ++   + N +                   T  QQ  +   E++A    DKPLPEKGKLLQ
Sbjct:   43 ELRKRDEQLIHLEDVLTKTLKERDEALEKYNHLLLNNLLLQQKQQQNQNQKQELVTPPLSGASSIIEDEQVQPQQPQLNSNKSFSSSDTEESIMSPSVIDPVTMNQQIEVSGDEMLATLLPDKPLPEKGKLLQ 175          
BLAST of CD858796 vs. TAIR peptide
Match: AT5G22930.1 (| Symbols: | Protein of unknown function (DUF1635) | chr5:7668229-7669315 REVERSE LENGTH=238)

HSP 1 Score: 75.8702 bits (185), Expect = 7.134e-15
Identity = 49/128 (38.28%), Postives = 66/128 (51.56%), Query Frame = 3
Query:    3 ELRKRDQQLLNLKDILNKVIRERDEAHEKCXXXXXXXXXXXXXXXXXXXXXXXPLSGISSVEDEQ---QQHKRGIESCNNNGLXXXXXXXXXXXXXPPTATEQQQQPMMMIELIAKDKPLPEKGKLLQ 377
            E+RKRD+QL++LKDIL K I+ERDEA EKC                       PLSG SS+EDEQ   QQ +      +++               PP   E+     ++++ + +DKPLPEKGKLLQ
Sbjct:   44 EIRKRDEQLIHLKDILTKTIKERDEALEKC-----QRLMFDSHSLQQQKHMTPPLSGASSIEDEQVQPQQLRSNKSFSSSDCEESIMSPTDHIMNPPPCQLEEVSGTEIIMDPLLQDKPLPEKGKLLQ 166          
BLAST of CD858796 vs. TAIR peptide
Match: AT3G44940.1 (| Symbols: | Protein of unknown function (DUF1635) | chr3:16413861-16415134 REVERSE LENGTH=250)

HSP 1 Score: 61.2326 bits (147), Expect = 1.818e-10
Identity = 48/133 (36.09%), Postives = 63/133 (47.37%), Query Frame = 3
Query:    3 ELRKRDQQLLNLKDILNKVIRERDEAHEK----CXXXXXXXXXXXXXXXXXXXXXXXPLSGISS-VEDEQQQHKRGIESCNNNGLXXXXXXXXXXXXXPPTATEQQQQPMMMIELIA---KDKPLPEKGKLLQ 377
            ELRKRD+QL++L+D+L K ++ERDEA EK                            PLSG SS +EDEQ Q ++   + N +                   T  QQ  +   E++A    DKPLPEKGKLLQ
Sbjct:   43 ELRKRDEQLIHLEDVLTKTLKERDEALEKYNHLLLNNLLLQQKQQQNQNQKQELVTPPLSGASSIIEDEQVQPQQPQLNSNKSFSSSDTEESIMSPSVIDPVTMNQQIEVSGDEMLATLLPDKPLPEKGKLLQ 175          
BLAST of CD858796 vs. TAIR peptide
Match: AT5G22930.1 (| Symbols: | Protein of unknown function (DUF1635) | chr5:7668229-7669315 REVERSE LENGTH=238)

HSP 1 Score: 75.8702 bits (185), Expect = 7.134e-15
Identity = 49/128 (38.28%), Postives = 66/128 (51.56%), Query Frame = 3
Query:    3 ELRKRDQQLLNLKDILNKVIRERDEAHEKCXXXXXXXXXXXXXXXXXXXXXXXPLSGISSVEDEQ---QQHKRGIESCNNNGLXXXXXXXXXXXXXPPTATEQQQQPMMMIELIAKDKPLPEKGKLLQ 377
            E+RKRD+QL++LKDIL K I+ERDEA EKC                       PLSG SS+EDEQ   QQ +      +++               PP   E+     ++++ + +DKPLPEKGKLLQ
Sbjct:   44 EIRKRDEQLIHLKDILTKTIKERDEALEKC-----QRLMFDSHSLQQQKHMTPPLSGASSIEDEQVQPQQLRSNKSFSSSDCEESIMSPTDHIMNPPPCQLEEVSGTEIIMDPLLQDKPLPEKGKLLQ 166          
BLAST of CD858796 vs. TAIR peptide
Match: AT3G44940.1 (| Symbols: | Protein of unknown function (DUF1635) | chr3:16413861-16415134 REVERSE LENGTH=250)

HSP 1 Score: 61.2326 bits (147), Expect = 1.818e-10
Identity = 48/133 (36.09%), Postives = 63/133 (47.37%), Query Frame = 3
Query:    3 ELRKRDQQLLNLKDILNKVIRERDEAHEK----CXXXXXXXXXXXXXXXXXXXXXXXPLSGISS-VEDEQQQHKRGIESCNNNGLXXXXXXXXXXXXXPPTATEQQQQPMMMIELIA---KDKPLPEKGKLLQ 377
            ELRKRD+QL++L+D+L K ++ERDEA EK                            PLSG SS +EDEQ Q ++   + N +                   T  QQ  +   E++A    DKPLPEKGKLLQ
Sbjct:   43 ELRKRDEQLIHLEDVLTKTLKERDEALEKYNHLLLNNLLLQQKQQQNQNQKQELVTPPLSGASSIIEDEQVQPQQPQLNSNKSFSSSDTEESIMSPSVIDPVTMNQQIEVSGDEMLATLLPDKPLPEKGKLLQ 175          
BLAST of CD858796 vs. TrEMBL
Match: C6TJV0_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 9.994e-14
Identity = 55/123 (44.72%), Postives = 65/123 (52.85%), Query Frame = 3
Query:    9 RKRDQQLLNLKDILNKVIRERDEAHEKCXXXXXXXXXXXXXXXXXXXXXXXPLSGISSVEDEQQQHKRGIESCNNNGLXXXXXXXXXXXXXPPTATEQQQQPMMMIELIAKDKPLPEKGKLLQ 377
            +KRD+QLLNLKD+L+K IRERDEA EKC                       P+SGISS+EDE    +RGI+S N + L                  + Q Q   MIEL   DKPLPEKGKLLQ
Sbjct:    8 KKRDEQLLNLKDLLSKTIRERDEAQEKC-----QRLLLEKLVFQQQQQQAAPVSGISSIEDEP---RRGIDSNNGHSLSDCEESIVSSPVI-DHLPQPQPQTQSMIEL-TPDKPLPEKGKLLQ 120          
BLAST of CD858796 vs. TrEMBL
Match: Q9FFB5_ARATH (Emb|CAB89309.1 OS=Arabidopsis thaliana GN=At5g22930 PE=4 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 1.885e-12
Identity = 49/128 (38.28%), Postives = 66/128 (51.56%), Query Frame = 3
Query:    3 ELRKRDQQLLNLKDILNKVIRERDEAHEKCXXXXXXXXXXXXXXXXXXXXXXXPLSGISSVEDEQ---QQHKRGIESCNNNGLXXXXXXXXXXXXXPPTATEQQQQPMMMIELIAKDKPLPEKGKLLQ 377
            E+RKRD+QL++LKDIL K I+ERDEA EKC                       PLSG SS+EDEQ   QQ +      +++               PP   E+     ++++ + +DKPLPEKGKLLQ
Sbjct:   54 EIRKRDEQLIHLKDILTKTIKERDEALEKC-----QRLMFDSHSLQQQKHMTPPLSGASSIEDEQVQPQQLRSNKSFSSSDCEESIMSPTDHIMNPPPCQLEEVSGTEIIMDPLLQDKPLPEKGKLLQ 176          
BLAST of CD858796 vs. TrEMBL
Match: B9HQN8_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_558314 PE=4 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 2.462e-12
Identity = 55/133 (41.35%), Postives = 63/133 (47.37%), Query Frame = 3
Query:    3 ELRKRDQQLLNLKDILNKVIRERDEAHEKCXXXXXXXXXXXXXXXXXXXXXXXPLSGISSVEDEQQQHKRGIESCNNNGLXXXXXXXXXXXXXPPTATEQQQQ--------PMMMIELIAKDKPLPEKGKLLQ 377
            ELRK+D QL +LKD+L K IRERDEA EKC                       PLSGISS+EDE    +RGI+S N                  PT    Q          P   IEL+  +KPLPEKGKLLQ
Sbjct:   44 ELRKKDDQLFHLKDLLIKAIRERDEAQEKC---QRLVTEKVLLQQQPQHHQNAPLSGISSIEDEP---RRGIDSSNGFSSSDCEESIVSSPVIDPTPQPSQLPPPAAPQTIPQAAIELV-PEKPLPEKGKLLQ 169          
BLAST of CD858796 vs. TrEMBL
Match: D7M1L0_ARALY (Putative uncharacterized protein OS=Arabidopsis lyrata subsp. lyrata GN=ARALYDRAFT_351315 PE=4 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 2.084e-11
Identity = 48/128 (37.50%), Postives = 64/128 (50.00%), Query Frame = 3
Query:    3 ELRKRDQQLLNLKDILNKVIRERDEAHEKCXXXXXXXXXXXXXXXXXXXXXXXPLSGISSVEDEQ---QQHKRGIESCNNNGLXXXXXXXXXXXXXPPTATEQQQQPMMMIELIAKDKPLPEKGKLLQ 377
            E+RKRD+QL++LKDI+ K I+ERDEA EKC                       PLSG SS+EDEQ   QQ        +++               PP+  E+     + ++ +  DKPLPEKGKLLQ
Sbjct:   44 EIRKRDEQLIHLKDIITKTIKERDEALEKC-----QRLMFDNHSLQQQKHMTPPLSGASSIEDEQVQPQQLGSNKSFSSSDCEESIMSPTDHVMNPPPSQLEEVSGTEITMDPLFPDKPLPEKGKLLQ 166          
BLAST of CD858796 vs. TrEMBL
Match: B9N869_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_786100 PE=4 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 3.554e-11
Identity = 52/133 (39.10%), Postives = 64/133 (48.12%), Query Frame = 3
Query:    3 ELRKRDQQLLNLKDILNKVIRERDEAHEKCXXXXXXXXXXXXXXXXXXXXXXXPLSGISSVEDEQQQHKRGIES--------CNNNGLXXXXXXXXXXXXXPPTATEQQQQPMMMIELIAKDKPLPEKGKLLQ 377
            ELRK+D QL +LKD+L+K IRERD+A EK                        PLSGISS+EDE    +RGI+S        C  + +              P     Q  P   IEL+  +KPLPEKGKLLQ
Sbjct:   25 ELRKKDDQLFHLKDLLSKAIRERDDAQEK----WKRLAIEKVLLQQQQHHQNAPLSGISSIEDEP---RRGIDSSNGFSSSDCEESIVSSPVIDQTPQPSQLPQTAAPQTIPQAAIELV-PEKPLPEKGKLLQ 149          
BLAST of CD858796 vs. TrEMBL
Match: B9SCJ6_RICCO (Putative uncharacterized protein OS=Ricinus communis GN=RCOM_0474610 PE=4 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 4.642e-11
Identity = 53/133 (39.85%), Postives = 63/133 (47.37%), Query Frame = 3
Query:    3 ELRKRDQQLLNLKDILNKVIRERDEAHEKCXXXXXXXXXXXXXXXXXXXXXXXPLSGISSVEDEQQQHKRGIESCN-------NNGLXXXXXXXXXXXXXPPTA-TEQQQQPMMMIELIAKDKPLPEKGKLLQ 377
            ELRKRD QL+ LKD+L+K+IRERDEA EKC                       PLSGISS+EDE    +R I+S N          +             PPTA +     P      +   KPLPEKGKLLQ
Sbjct:   44 ELRKRDDQLIQLKDLLSKMIRERDEAIEKC----QRLLLEKLLLQQQQQQQNAPLSGISSIEDEP---RRAIDSNNGFSSSDCEESIVSSPVIDQIPPQLPPTAPSSSVVAPQGTTLEMVPQKPLPEKGKLLQ 169          
BLAST of CD858796 vs. TrEMBL
Match: D7LNJ4_ARALY (Putative uncharacterized protein OS=Arabidopsis lyrata subsp. lyrata GN=ARALYDRAFT_484892 PE=4 SV=1)

HSP 1 Score: 63.5438 bits (153), Expect = 9.680e-9
Identity = 48/131 (36.64%), Postives = 64/131 (48.85%), Query Frame = 3
Query:    3 ELRKRDQQLLNLKDILNKVIRERDEAHEKC--XXXXXXXXXXXXXXXXXXXXXXXPLSGISS-VEDEQQQHKRGIESCNNNGLXXXXXXXXXXXXXPPTATEQQQQPMMMIELIA---KDKPLPEKGKLLQ 377
            ELRKRD+QL++L+D+L K ++ERD+A EKC                         PLSG SS +EDEQ Q ++   + N +                   T  QQ  +   EL+A    +KPLPEKGKLLQ
Sbjct:   43 ELRKRDEQLIHLEDVLTKTLKERDDALEKCHHLLLNNLLLQQKQQQNQKQELITPPLSGASSIIEDEQVQPQQPQLNSNKSFSSSDTEESIMSPSVIDPVTMNQQIEVSGDELMATLLPEKPLPEKGKLLQ 173          
BLAST of CD858796 vs. TrEMBL
Match: Q9LXI1_ARATH (Putative uncharacterized protein F14D17_10 OS=Arabidopsis thaliana GN=F14D17_10 PE=4 SV=1)

HSP 1 Score: 61.2326 bits (147), Expect = 4.804e-8
Identity = 48/133 (36.09%), Postives = 63/133 (47.37%), Query Frame = 3
Query:    3 ELRKRDQQLLNLKDILNKVIRERDEAHEK----CXXXXXXXXXXXXXXXXXXXXXXXPLSGISS-VEDEQQQHKRGIESCNNNGLXXXXXXXXXXXXXPPTATEQQQQPMMMIELIA---KDKPLPEKGKLLQ 377
            ELRKRD+QL++L+D+L K ++ERDEA EK                            PLSG SS +EDEQ Q ++   + N +                   T  QQ  +   E++A    DKPLPEKGKLLQ
Sbjct:   13 ELRKRDEQLIHLEDVLTKTLKERDEALEKYNHLLLNNLLLQQKQQQNQNQKQELVTPPLSGASSIIEDEQVQPQQPQLNSNKSFSSSDTEESIMSPSVIDPVTMNQQIEVSGDEMLATLLPDKPLPEKGKLLQ 145          
BLAST of CD858796 vs. TrEMBL
Match: Q84JJ0_ARATH (Putative uncharacterized protein At3g44940 OS=Arabidopsis thaliana GN=At3g44940 PE=2 SV=1)

HSP 1 Score: 61.2326 bits (147), Expect = 4.804e-8
Identity = 48/133 (36.09%), Postives = 63/133 (47.37%), Query Frame = 3
Query:    3 ELRKRDQQLLNLKDILNKVIRERDEAHEK----CXXXXXXXXXXXXXXXXXXXXXXXPLSGISS-VEDEQQQHKRGIESCNNNGLXXXXXXXXXXXXXPPTATEQQQQPMMMIELIA---KDKPLPEKGKLLQ 377
            ELRKRD+QL++L+D+L K ++ERDEA EK                            PLSG SS +EDEQ Q ++   + N +                   T  QQ  +   E++A    DKPLPEKGKLLQ
Sbjct:   43 ELRKRDEQLIHLEDVLTKTLKERDEALEKYNHLLLNNLLLQQKQQQNQNQKQELVTPPLSGASSIIEDEQVQPQQPQLNSNKSFSSSDTEESIMSPSVIDPVTMNQQIEVSGDEMLATLLPDKPLPEKGKLLQ 175          
BLAST of CD858796 vs. Lotus protein
Match: chr3.CM0070.290.r2.m (+ phase: 0 )

HSP 1 Score: 78.5666 bits (192), Expect = 6.834e-16
Identity = 59/132 (44.70%), Postives = 66/132 (50.00%), Query Frame = 3
Query:    3 ELRKRDQQLLNLKDILNKVIRERDEAHEKCXXXXXXXXXXXXXXXXXXXXXXXPLSGISSVEDEQQQHKRGIESCNNNGLXXXXXXXXXXXXXPPTATEQQQQPM-------MMIELIAKDKPLPEKGKLLQ 377
            ELRKRD QLLNLKD+LN  IRERDEA EKC                       P SG+SS+EDE    +RGI+S  NNGL                   Q Q P+        MIEL   +KPLPEKGKLLQ
Sbjct:   44 ELRKRDDQLLNLKDLLNNTIRERDEAQEKC-QRLLLEKFLFQHQQQQQQQQADPNSGVSSIEDEP---RRGIDS--NNGLSSSDCEESIVSSPVFDNMPQPQFPLPLPSVAQSMIEL-TPEKPLPEKGKLLQ 168          
BLAST of CD858796 vs. Soybean peptides
Match: Glyma12g08590.1|PACid:16286880 ()

HSP 1 Score: 96.6709 bits (239), Expect = 5.592e-21
Identity = 63/130 (48.46%), Postives = 71/130 (54.62%), Query Frame = 3
Query:    3 ELRKRDQQLLNLKDILNKVIRERDEAHEKCXXXXXXXXXXXXXXXXXXXXXXXPLSGISSVEDEQQQHKRGIESCNNNGL-----XXXXXXXXXXXXXPPTATEQQQQPMMMIELIAKDKPLPEKGKLLQ 377
            ELRKRD QLL LK++LNKVIRERDEA EKC                       P SG+SS+EDE    +RGI   +NNGL                  PP   +QQQ P  MIELI+ DKPLPEKGKLLQ
Sbjct:   44 ELRKRDDQLLTLKELLNKVIRERDEAQEKC--------QRLVLEKMVFQHQTAPASGVSSIEDEP---RRGINDSSNNGLSSSDCEESIVSSPVMEHLPP---QQQQLPESMIELISPDKPLPEKGKLLQ 159          
BLAST of CD858796 vs. Soybean peptides
Match: Glyma11g19890.1|PACid:16284394 ()

HSP 1 Score: 88.5817 bits (218), Expect = 1.523e-18
Identity = 61/139 (43.88%), Postives = 73/139 (52.52%), Query Frame = 3
Query:    3 ELRKRDQQLLNLKDILNKVIRERDEAHEKCXXXXXXXXXXXXXXXXXXXXXXXPLSGISSVEDEQQQHKRGIES-CNNNGL-------------XXXXXXXXXXXXXPPTATEQQQQPMMMIELIAKDKPLPEKGKLLQ 377
            ELRKRD QLL LK++LNKVIRERDEA EKC                       P SG+SS+EDE +  + GI +  +NNGL                           P++  QQQ P  MIELI++DKPLPEKGKLLQ
Sbjct:   44 ELRKRDDQLLTLKELLNKVIRERDEAQEKC-----QRLLVLEKMVFHQQHQTAPASGVSSIEDEPR--RGGINNDSSNNGLSSSDCEESIVSSPLMEHLPPQPHHHAGPSSQLQQQLPESMIELISQDKPLPEKGKLLQ 175          
BLAST of CD858796 vs. Soybean peptides
Match: Glyma13g39690.1|PACid:16293197 ()

HSP 1 Score: 85.5001 bits (210), Expect = 1.289e-17
Identity = 60/125 (48.00%), Postives = 68/125 (54.40%), Query Frame = 3
Query:    3 ELRKRDQQLLNLKDILNKVIRERDEAHEKCXXXXXXXXXXXXXXXXXXXXXXXPLSGISSVEDEQQQHKRGIESCNNNGLXXXXXXXXXXXXXPPTATEQQQQPMMMIELIAKDKPLPEKGKLLQ 377
            EL+KRD+QLLNLKD+L+K IRERDEA EKC                       P+SGISS+EDE    +RGI+S  NNG              P      Q QP  MIEL   DKPLPEKGKLLQ
Sbjct:   44 ELKKRDEQLLNLKDLLSKTIRERDEAQEKC-----QRLLLEKLVFQQQLQHAAPVSGISSIEDEP---RRGIDS--NNG-HSSSDCEESIVSSPVIDHLPQPQPQSMIEL-TPDKPLPEKGKLLQ 156          
BLAST of CD858796 vs. Soybean peptides
Match: Glyma12g30220.1|PACid:16288378 ()

HSP 1 Score: 83.5741 bits (205), Expect = 4.899e-17
Identity = 57/125 (45.60%), Postives = 67/125 (53.60%), Query Frame = 3
Query:    3 ELRKRDQQLLNLKDILNKVIRERDEAHEKCXXXXXXXXXXXXXXXXXXXXXXXPLSGISSVEDEQQQHKRGIESCNNNGLXXXXXXXXXXXXXPPTATEQQQQPMMMIELIAKDKPLPEKGKLLQ 377
            EL+KRD+QLLNLKD+L+K IRERDEA EKC                       P+SGISS+EDE    +RGI+S N + L                  + Q Q   MIEL   DKPLPEKGKLLQ
Sbjct:   44 ELKKRDEQLLNLKDLLSKTIRERDEAQEKC-----QRLLLEKLVFQQQQQQAAPVSGISSIEDEP---RRGIDSNNGHSLSDCEESIVSSPVI-DHLPQPQPQTQSMIEL-TPDKPLPEKGKLLQ 158          
BLAST of CD858796 vs. Medicago proteins
Match: IMGA|Medtr4g057470.1 (Unknown Protein (AHRD V1); contains Interpro domain(s) IPR012862 Protein of unknown function DUF1635 chr04_pseudomolecule_IMGAG_V3.5 17672170-17673744 E EGN_Mt100125 20100825)

HSP 1 Score: 105.145 bits (261), Expect = 9.816e-24
Identity = 68/125 (54.40%), Postives = 75/125 (60.00%), Query Frame = 3
Query:    3 ELRKRDQQLLNLKDILNKVIRERDEAHEKCXXXXXXXXXXXXXXXXXXXXXXXPLSGISSVEDEQQQHKRGIESCNNNGLXXXXXXXXXXXXXPPTATEQQQQPMMMIELIAKDKPLPEKGKLLQ 377
            ELRKRD+QL NLK++ NKVIRERDEA EKC                       PLSGISS+EDEQ Q KRGIES +NNG+               T TEQ    MMMI+ IAKDKPLPEKGKLLQ
Sbjct:   45 ELRKRDEQLHNLKELFNKVIRERDEAQEKC----QRLFLEKLLFQQQKQQNQDPLSGISSIEDEQIQ-KRGIES-SNNGISLSDCEESIVSSPQQTRTEQPM--MMMIDSIAKDKPLPEKGKLLQ 161          
The following BLAST results are available for this feature:
Homology Analysis: Pisum sativum unigene v1 vs Trembl
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Trembl)
Total hits: 9
Match NameE-valueIdentityDescription
C6TJV0_SOYBN7.992e-1444.72Putative uncharacterized protein OS=Glycine max PE... [more]
Q9FFB5_ARATH1.507e-1238.28Emb|CAB89309.1 OS=Arabidopsis thaliana GN=At5g2293... [more]
B9HQN8_POPTR1.968e-1241.35Predicted protein OS=Populus trichocarpa GN=POPTRD... [more]
D7M1L0_ARALY1.666e-1137.50Putative uncharacterized protein OS=Arabidopsis ly... [more]
B9N869_POPTR2.842e-1139.10Predicted protein OS=Populus trichocarpa GN=POPTRD... [more]
B9SCJ6_RICCO3.712e-1139.85Putative uncharacterized protein OS=Ricinus commun... [more]
D7LNJ4_ARALY7.741e-936.64Putative uncharacterized protein OS=Arabidopsis ly... [more]
Q9LXI1_ARATH3.842e-836.09Putative uncharacterized protein F14D17_10 OS=Arab... [more]
Q84JJ0_ARATH3.842e-836.09Putative uncharacterized protein At3g44940 OS=Arab... [more]
back to top
Homology Analysis: Pisum sativum unigene v1 vs TAIR 10 peptide
Analysis Date: 2011-02-03 (Homology Analysis: Pisum sativum unigene v1 vs TAIR 10 peptide)
Total hits: 2
Match NameE-valueIdentityDescription
AT5G22930.17.134e-1538.28| Symbols: | Protein of unknown function (DUF1635... [more]
AT3G44940.11.818e-1036.09| Symbols: | Protein of unknown function (DUF1635... [more]
back to top
Homology Analysis: Pisum sativum unigene v2 vs TAIR 10 peptide
Analysis Date: 2011-04-21 (Homology Analysis: Pisum sativum unigene v2 vs TAIR 10 peptide)
Total hits: 2
Match NameE-valueIdentityDescription
AT5G22930.17.134e-1538.28| Symbols: | Protein of unknown function (DUF1635... [more]
AT3G44940.11.818e-1036.09| Symbols: | Protein of unknown function (DUF1635... [more]
back to top
Homology Analysis: Pisum sativum unigene v2 vs Trembl
Analysis Date: 2011-04-27 (Homology Analysis: Pisum sativum unigene v2 vs Trembl)
Total hits: 9
Match NameE-valueIdentityDescription
C6TJV0_SOYBN9.994e-1444.72Putative uncharacterized protein OS=Glycine max PE... [more]
Q9FFB5_ARATH1.885e-1238.28Emb|CAB89309.1 OS=Arabidopsis thaliana GN=At5g2293... [more]
B9HQN8_POPTR2.462e-1241.35Predicted protein OS=Populus trichocarpa GN=POPTRD... [more]
D7M1L0_ARALY2.084e-1137.50Putative uncharacterized protein OS=Arabidopsis ly... [more]
B9N869_POPTR3.554e-1139.10Predicted protein OS=Populus trichocarpa GN=POPTRD... [more]
B9SCJ6_RICCO4.642e-1139.85Putative uncharacterized protein OS=Ricinus commun... [more]
D7LNJ4_ARALY9.680e-936.64Putative uncharacterized protein OS=Arabidopsis ly... [more]
Q9LXI1_ARATH4.804e-836.09Putative uncharacterized protein F14D17_10 OS=Arab... [more]
Q84JJ0_ARATH4.804e-836.09Putative uncharacterized protein At3g44940 OS=Arab... [more]
back to top
Homology Analysis: Pisum sativum unigene v2 vs Lotus proteins
Analysis Date: 2011-04-21 (Homology Analysis: Pisum sativum unigene v2 vs Lotus proteins)
Total hits: 1
Match NameE-valueIdentityDescription
chr3.CM0070.290.r2.m6.834e-1644.70+ phase: 0 [more]
back to top
Homology Analysis: Pisum sativum unigene v2 vs Soybean peptides
Analysis Date: 2011-04-21 (Homology Analysis: Pisum sativum unigene v2 vs Soybean peptides)
Total hits: 4
Match NameE-valueIdentityDescription
Glyma12g08590.1|PACid:162868805.592e-2148.46[more]
Glyma11g19890.1|PACid:162843941.523e-1843.88[more]
Glyma13g39690.1|PACid:162931971.289e-1748.00[more]
Glyma12g30220.1|PACid:162883784.899e-1745.60[more]
back to top
Homology Analysis: Pisum sativum unigene v2 vs Medicago proteins
Analysis Date: 2011-04-21 (Homology Analysis: Pisum sativum unigene v2 vs Medicago proteins)
Total hits: 1
Match NameE-valueIdentityDescription
IMGA|Medtr4g057470.19.816e-2454.40Unknown Protein (AHRD V1); contains Interpro domai... [more]
back to top
InterPro
Analysis Name: InterProScan analysis for Pisum sativum unigene v2
Date Performed: 2011-04-27
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableSEGsegsegcoord: 5..18
score: NAcoord: 29..42
score
NoneNo IPR availableSEGsegsegcoord: 31..53
score: NAcoord: 81..93
score
NoneNo IPR availableSEGsegsegcoord: 13..35
score: NAcoord: 59..64
score: NAcoord: 77..90
score
NoneNo IPR availableSEGsegsegcoord: 21..29
score
IPR012862Protein of unknown function DUF1635PFAMPF07795DUF1635coord: 1..125
score: 1

Analysis Name: InterProScan analysis for Pisum sativum unigene v1
Date Performed: 2010-12-29
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableSEGsegsegcoord: 5..18
score: NAcoord: 29..42
score
NoneNo IPR availableSEGsegsegcoord: 31..53
score: NAcoord: 81..93
score
NoneNo IPR availableSEGsegsegcoord: 13..35
score: NAcoord: 59..64
score: NAcoord: 77..90
score
NoneNo IPR availableSEGsegsegcoord: 21..29
score
IPR012862Protein of unknown function DUF1635PFAMPF07795DUF1635coord: 1..125
score: 1

Properties
Property NameValue
Singlet in analysisPisum sativum unigene v2
Singlet in analysisPisum sativum unigene v1
Sequences
The following sequences are available for this feature:

EST sequence

>CD858796 ID=CD858796|Name=CD858796|organism=Pisum sativum|type=EST|length=385bp
AAGAATTAAGAAAAAGAGATCAACAGTTACTTAACCTAAAAGACATTCTC
AACAAAGTCATAAGAGAAAGAGATGAAGCACATGAAAAATGCCAAAGACT
TTTCTTAGACAAGTTACTTTTCCAACAACAACATCAGCAAAAACAAAAAC
AAAAACAAGATCCTCTGTCTGGAATTTCAAGCGTCGAAGATGAACAACAA
CAACACAAACGAGGAATTGAATCTTGTAACAACAATGGCTTGTCATCATC
AGATTGTGAAGAAAGCATAGTTTCCTCCTCACCACCAACAGCAACAGAAC
AACAACAACAACCAATGATGATGATTGAGTTAATAGCAAAAGATAAACCT
TTGCCGGAAAAAGGTAAACTTTTGCAGCCAGCTGA
back to top
Annotated Terms
The following terms have been associated with this EST:
Vocabulary: INTERPRO
TermDefinition
IPR012862DUF1635