CD858891

EST Overview
NameCD858891
Unique NameCD858891
TypeEST
OrganismPisum sativum (pea)
Sequence length734
Libraries
Library NameType
LIBEST_013997 CIcdna_library
Unigenes
This EST is part of the following unigenes:
Unigene NameAnalysis NameSequence type in Unigene
Pisum sativum unigene v1Pisum sativum unigene v1EST
Homology
BLAST of CD858891 vs. TrEMBL
Match: C6T858_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1)

HSP 1 Score: 199.904 bits (507), Expect = 1.217e-60
Identity = 96/130 (73.85%), Postives = 108/130 (83.08%), Query Frame = -3
Query:  190 MFSKTWKPKKTGVIKGPTIFSDDPVRRSANHSEQREKLGLNSAPKGQSNPRRAISEPTNAFERVEVEKGKQDDALSDISDLLGELKGMAIDMGSEIDKQTKAIDGFEKDTEKLNDRMNGANRHTRHLLGK 579
            MFSKTWKPKKTG I GP +F DDPVRR  NH EQREKLGL SAPKGQS  R  +SEP+NA E+VEVEKGKQDDALSD+SDLLGELKGMAIDMGSEI +Q +A+DGF+ D EKL  R+NGAN+ +  LLGK
Sbjct:  163 MFSKTWKPKKTGTITGPVVFGDDPVRRKGNHLEQREKLGLTSAPKGQSKSRPTLSEPSNALEKVEVEKGKQDDALSDLSDLLGELKGMAIDMGSEIGRQNQALDGFDNDMEKLTVRVNGANQRSHRLLGK 292          

HSP 2 Score: 57.3806 bits (137), Expect = 1.217e-60
Identity = 26/31 (83.87%), Postives = 28/31 (90.32%), Query Frame = -1
Query:  603 QTLVMLHHPGEQITRSHDIAAGIDHDLSRGE 695
            +TLVMLHH GEQITRSH +AA IDHDLSRGE
Sbjct:  124 KTLVMLHHQGEQITRSHHVAADIDHDLSRGE 154          

HSP 3 Score: 22.7126 bits (47), Expect = 1.217e-60
Identity = 9/12 (75.00%), Postives = 12/12 (100.00%), Query Frame = -2
Query:  692 KIAEEMREEASR 727
            KIAEEMRE+A++
Sbjct:  113 KIAEEMREDATK 124          
BLAST of CD858891 vs. TrEMBL
Match: C6T803_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1)

HSP 1 Score: 194.897 bits (494), Expect = 3.095e-58
Identity = 94/130 (72.31%), Postives = 106/130 (81.54%), Query Frame = -3
Query:  190 MFSKTWKPKKTGVIKGPTIFSDDPVRRSANHSEQREKLGLNSAPKGQSNPRRAISEPTNAFERVEVEKGKQDDALSDISDLLGELKGMAIDMGSEIDKQTKAIDGFEKDTEKLNDRMNGANRHTRHLLGK 579
            MFSKTWKPKKTG I GP +F +DPVR+  NH EQREKLGL SAPKGQS  R  +SEP+N  E+VEVEKGKQDDALSD+SDLLGELKGMAIDMGSEI  Q +A+DGF+ D EKL  R+NGAN+  R LLGK
Sbjct:  162 MFSKTWKPKKTGTITGPVVFGEDPVRKKGNHLEQREKLGLTSAPKGQSKSRTTLSEPSNVLEKVEVEKGKQDDALSDLSDLLGELKGMAIDMGSEIGSQNQALDGFDNDMEKLIVRVNGANQRGRRLLGK 291          

HSP 2 Score: 54.299 bits (129), Expect = 3.095e-58
Identity = 25/31 (80.65%), Postives = 27/31 (87.10%), Query Frame = -1
Query:  603 QTLVMLHHPGEQITRSHDIAAGIDHDLSRGE 695
            +TLVMLH  GEQITRSH +AA IDHDLSRGE
Sbjct:  123 KTLVMLHQQGEQITRSHHVAADIDHDLSRGE 153          

HSP 3 Score: 22.7126 bits (47), Expect = 3.095e-58
Identity = 9/12 (75.00%), Postives = 12/12 (100.00%), Query Frame = -2
Query:  692 KIAEEMREEASR 727
            KIAEEMRE+A++
Sbjct:  112 KIAEEMREDATK 123          
BLAST of CD858891 vs. TrEMBL
Match: C6TJG5_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1)

HSP 1 Score: 179.104 bits (453), Expect = 2.007e-52
Identity = 89/130 (68.46%), Postives = 101/130 (77.69%), Query Frame = -3
Query:  190 MFSKTWKPKKTGVIKGPTIFSDDPVRRSANHSEQREKLGLNSAPKGQSNPRRAISEPTNAFERVEVEKGKQDDALSDISDLLGELKGMAIDMGSEIDKQTKAIDGFEKDTEKLNDRMNGANRHTRHLLGK 579
            +FSKTWKPKKT  I GP I  DDPVRR  NH EQREKLGL SAPKGQS  R    EPTNAFE+VEVEK KQDDALSD+SDLLGELKGMA+DMGSEI++  KA++    D ++LN R+ GAN+  R LLGK
Sbjct:  171 LFSKTWKPKKTRAITGPVIVGDDPVRRKGNHLEQREKLGLTSAPKGQSKLRSPPQEPTNAFEKVEVEKNKQDDALSDLSDLLGELKGMAVDMGSEIERHNKALNHLYDDVDELNFRVIGANQRGRRLLGK 300          

HSP 2 Score: 52.373 bits (124), Expect = 2.007e-52
Identity = 24/31 (77.42%), Postives = 26/31 (83.87%), Query Frame = -1
Query:  603 QTLVMLHHPGEQITRSHDIAAGIDHDLSRGE 695
            QTLV LH  GEQITRSH +AA IDHDL+RGE
Sbjct:  132 QTLVTLHQQGEQITRSHHVAADIDHDLTRGE 162          
BLAST of CD858891 vs. TrEMBL
Match: B9IE11_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_824554 PE=4 SV=1)

HSP 1 Score: 163.696 bits (413), Expect = 1.345e-47
Identity = 79/130 (60.77%), Postives = 99/130 (76.15%), Query Frame = -3
Query:  190 MFSKTWKPKKTGVIKGPTIFSDDPVRRSANHSEQREKLGLNSAPKGQSNPRRAISEPTNAFERVEVEKGKQDDALSDISDLLGELKGMAIDMGSEIDKQTKAIDGFEKDTEKLNDRMNGANRHTRHLLGK 579
            MFSKTWKPKK   I GP I  D   +R  N  EQREKLGLN APKGQS+ R  + EPTNAF++VE+EK KQDD+LSD+S++LGELK MA+DMG+EID+QT ++D  + D ++LN R+ GAN+  R LLGK
Sbjct:  176 MFSKTWKPKKNRPITGPVITRDASPQRRGNQLEQREKLGLNPAPKGQSSMRTPLPEPTNAFQKVELEKSKQDDSLSDLSNILGELKNMAVDMGTEIDRQTNSLDHLQNDVDELNYRVRGANQRGRRLLGK 305          

HSP 2 Score: 51.2174 bits (121), Expect = 1.345e-47
Identity = 23/34 (67.65%), Postives = 26/34 (76.47%), Query Frame = -1
Query:  603 GGFQTLVMLHHPGEQITRSHDIAAGIDHDLSRGE 704
            G  +TL+ LH  GEQITR+HD A  IDHDLSRGE
Sbjct:  134 GATRTLITLHQQGEQITRTHDAAVEIDHDLSRGE 167          

HSP 3 Score: 21.1718 bits (43), Expect = 1.345e-47
Identity = 9/12 (75.00%), Postives = 11/12 (91.67%), Query Frame = -2
Query:  692 KIAEEMREEASR 727
            KIAE+MRE A+R
Sbjct:  126 KIAEDMREGATR 137          
BLAST of CD858891 vs. TrEMBL
Match: B9RLS5_RICCO (Synaptosomal associated protein, putative OS=Ricinus communis GN=RCOM_1470520 PE=4 SV=1)

HSP 1 Score: 166.777 bits (421), Expect = 3.160e-46
Identity = 80/130 (61.54%), Postives = 102/130 (78.46%), Query Frame = -3
Query:  190 MFSKTWKPKKTGVIKGPTIFSDDPVRRSANHSEQREKLGLNSAPKGQSNPRRAISEPTNAFERVEVEKGKQDDALSDISDLLGELKGMAIDMGSEIDKQTKAIDGFEKDTEKLNDRMNGANRHTRHLLGK 579
            +FS+TWKPKK   I GP I  DD  +R  NH EQREKLGLN+APKG+++ R    EPTNA+++VE+EK KQDDALSD+S+LLGELK MA+DMGSEI++QTKA+D  + D ++LN R+ GAN+  R LLGK
Sbjct:  176 IFSRTWKPKKNRPITGPVITRDDSPKRRGNHLEQREKLGLNAAPKGRTSTRTPPPEPTNAYQKVEMEKTKQDDALSDLSNLLGELKDMAVDMGSEIERQTKALDHVQDDVDELNSRVRGANQRGRRLLGK 305          

HSP 2 Score: 43.5134 bits (101), Expect = 3.160e-46
Identity = 17/31 (54.84%), Postives = 25/31 (80.65%), Query Frame = -1
Query:  603 QTLVMLHHPGEQITRSHDIAAGIDHDLSRGE 695
            +T++ LH  GEQ+ R+H++A  +DHDLSRGE
Sbjct:  137 KTMITLHQQGEQMYRTHNVAVEMDHDLSRGE 167          

HSP 3 Score: 21.1718 bits (43), Expect = 3.160e-46
Identity = 8/12 (66.67%), Postives = 12/12 (100.00%), Query Frame = -2
Query:  692 KIAEEMREEASR 727
            KIAEE+RE+A++
Sbjct:  126 KIAEEIREDATK 137          
BLAST of CD858891 vs. TrEMBL
Match: D7MUI6_ARALY (Synaptosomal-associated protein 33 OS=Arabidopsis lyrata subsp. lyrata GN=SNAP33 PE=4 SV=1)

HSP 1 Score: 159.073 bits (401), Expect = 7.909e-45
Identity = 78/130 (60.00%), Postives = 94/130 (72.31%), Query Frame = -3
Query:  190 MFSKTWKPKKTGVIKGPTIFSDDPVRRSANHSEQREKLGLNSAPKGQSNPRRAISEPTNAFERVEVEKGKQDDALSDISDLLGELKGMAIDMGSEIDKQTKAIDGFEKDTEKLNDRMNGANRHTRHLLGK 579
            MFSKTWKPKKT  I GP I  D    R  NH E+REKLGLNSAPKGQS  R  + E  +A++RVE+EK KQDD LSD+SD+LGELK MA+DMGSEI+KQ K +D    D ++LN R+  +N+  R LLGK
Sbjct:  171 MFSKTWKPKKTRPINGPVITRDHSPTRRVNHLEKREKLGLNSAPKGQSRTREPLPESADAYQRVEMEKAKQDDGLSDLSDILGELKNMAVDMGSEIEKQNKGLDHLHDDVDELNFRVQQSNQRGRRLLGK 300          

HSP 2 Score: 46.9802 bits (110), Expect = 7.909e-45
Identity = 26/43 (60.47%), Postives = 29/43 (67.44%), Query Frame = -1
Query:  603 SEDSGGDARGGFQTLVMLHHPGEQITRSHDIAAGIDHDLSRGE 731
            +ED   DA    +TLVMLH  GEQITR+H  A  ID DLSRGE
Sbjct:  123 AEDIRSDAT---RTLVMLHEQGEQITRTHHKAVEIDQDLSRGE 162          
BLAST of CD858891 vs. TrEMBL
Match: B9I2W3_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_569939 PE=4 SV=1)

HSP 1 Score: 154.066 bits (388), Expect = 8.574e-44
Identity = 74/130 (56.92%), Postives = 94/130 (72.31%), Query Frame = -3
Query:  190 MFSKTWKPKKTGVIKGPTIFSDDPVRRSANHSEQREKLGLNSAPKGQSNPRRAISEPTNAFERVEVEKGKQDDALSDISDLLGELKGMAIDMGSEIDKQTKAIDGFEKDTEKLNDRMNGANRHTRHLLGK 579
            MFSKTWKPKK   I+GP I  D   RR  NH EQREKLGLN APK +S+ +  + E  NAF++VE EK KQDDALSD+S+++GELK MA+DMG+E D+Q  A+D  + D ++LN R+ GAN+   HLL K
Sbjct:  176 MFSKTWKPKKNRAIRGPVITRDASPRRRGNHLEQREKLGLNLAPKERSSTKTPLPETANAFQKVEFEKSKQDDALSDLSNVIGELKNMAVDMGAEFDRQVGALDHVQDDVDELNSRLGGANKRGLHLLRK 305          

HSP 2 Score: 48.521 bits (114), Expect = 8.574e-44
Identity = 21/34 (61.76%), Postives = 25/34 (73.53%), Query Frame = -1
Query:  603 GGFQTLVMLHHPGEQITRSHDIAAGIDHDLSRGE 704
            G   TL+ LH  GEQIT++H +A  IDHDLSRGE
Sbjct:  134 GATTTLITLHQQGEQITKTHSVAVEIDHDLSRGE 167          
BLAST of CD858891 vs. TrEMBL
Match: D7KQK9_ARALY (Synaptosomal-associated protein 30 OS=Arabidopsis lyrata subsp. lyrata GN=SNAP30 PE=4 SV=1)

HSP 1 Score: 154.451 bits (389), Expect = 4.561e-42
Identity = 75/130 (57.69%), Postives = 93/130 (71.54%), Query Frame = -3
Query:  190 MFSKTWKPKKTGVIKGPTIFSDDPVRRSANHSEQREKLGLNSAPKGQSNPRRAISEPTNAFERVEVEKGKQDDALSDISDLLGELKGMAIDMGSEIDKQTKAIDGFEKDTEKLNDRMNGANRHTRHLLGK 579
            MFSK WKPKKT  I GP I  D P ++S NH E+REKLGL +  +  S P   + +PTNA ++VE EK KQDD LSD+SD+LG+LK MA+DMGSEIDKQ KA+D    D ++LN R+ GAN+  RHLL K
Sbjct:  136 MFSKPWKPKKTKNITGPMITPDKPSKKSENHKEEREKLGLGAKGRSSSQPS-GLGQPTNALQKVEQEKAKQDDGLSDLSDILGDLKSMAVDMGSEIDKQNKALDHLGDDVDELNSRVQGANQRARHLLSK 264          

HSP 2 Score: 42.3578 bits (98), Expect = 4.561e-42
Identity = 23/43 (53.49%), Postives = 28/43 (65.12%), Query Frame = -1
Query:  603 SEDSGGDARGGFQTLVMLHHPGEQITRSHDIAAGIDHDLSRGE 731
            +ED   DA    +TL MLH  GEQI R+H +A  +D DLSRGE
Sbjct:   88 AEDIRSDAT---RTLEMLHQQGEQINRTHVMAVDMDKDLSRGE 127          
BLAST of CD858891 vs. TrEMBL
Match: B9RCW1_RICCO (Synaptosomal associated protein, putative OS=Ricinus communis GN=RCOM_1621450 PE=4 SV=1)

HSP 1 Score: 155.221 bits (391), Expect = 2.916e-41
Identity = 74/130 (56.92%), Postives = 98/130 (75.38%), Query Frame = -3
Query:  190 MFSKTWKPKKTGVIKGPTIFSDDPVRRSANHSEQREKLGLNSAPKGQSNPRRAISEPTNAFERVEVEKGKQDDALSDISDLLGELKGMAIDMGSEIDKQTKAIDGFEKDTEKLNDRMNGANRHTRHLLGK 579
            +FSK WKPKKT  I GP + +D+P ++S NH EQREKLGL    +G S P    SEPT+A ++VE+EK KQDDALSD+S++LG+LKGMA+DMG+EI++Q KA+D    D ++L  R+ GAN+  RHLLGK
Sbjct:  105 IFSKPWKPKKTRQITGPVVAADNPSKKSDNHKEQREKLGLGGK-RGHSAPTTPPSEPTSALQKVELEKAKQDDALSDLSNILGDLKGMAVDMGNEIERQNKALDHLSDDVDELKTRVKGANQRARHLLGK 233          

HSP 2 Score: 38.891 bits (89), Expect = 2.916e-41
Identity = 21/43 (48.84%), Postives = 29/43 (67.44%), Query Frame = -1
Query:  603 SEDSGGDARGGFQTLVMLHHPGEQITRSHDIAAGIDHDLSRGE 731
            +ED   DA    +TL  LH  GEQITR+H++A  ++ DLS+GE
Sbjct:   57 AEDIKQDAT---KTLDTLHAQGEQITRTHNMAVDMEKDLSKGE 96          
BLAST of CD858891 vs. TrEMBL
Match: Q6X9T4_HORVD (SNAP-34 OS=Hordeum vulgare var. distichum PE=2 SV=1)

HSP 1 Score: 151.369 bits (381), Expect = 2.412e-40
Identity = 76/130 (58.46%), Postives = 95/130 (73.08%), Query Frame = -3
Query:  190 MFSKTWKPKKTGVIKGPTIFSDDPVRRSANHSEQREKLGLNSAPKGQSNPRRAISEPTNAFERVEVEKGKQDDALSDISDLLGELKGMAIDMGSEIDKQTKAIDGFEKDTEKLNDRMNGANRHTRHLLGK 579
            +FSK WKPKK G I+GP +  DD   R  +H EQR KLGL+  P  +SN R+ +SEPT+  E+VEVEK KQDD LSD+SD+L ELKGMAIDMG+EI+ QTK +   EKD ++LN R+ GAN  TR LLG+
Sbjct:  181 LFSKKWKPKKNGAIRGPMLTRDDSFIRKGSHMEQRHKLGLSDRPH-RSNARQFLSEPTSGLEKVEVEKAKQDDGLSDLSDILTELKGMAIDMGTEIEGQTKDLGHAEKDFDELNYRVKGANARTRRLLGR 309          

HSP 2 Score: 39.6614 bits (91), Expect = 2.412e-40
Identity = 17/31 (54.84%), Postives = 23/31 (74.19%), Query Frame = -1
Query:  603 QTLVMLHHPGEQITRSHDIAAGIDHDLSRGE 695
            +TL+ +H  G+QI R+H +A  ID DLSRGE
Sbjct:  142 KTLLQVHQQGQQIRRTHAMAVDIDQDLSRGE 172          
BLAST of CD858891 vs. SwissProt
Match: SNP33_ARATH (SNAP25 homologous protein SNAP33 OS=Arabidopsis thaliana GN=SNAP33 PE=1 SV=1)

HSP 1 Score: 160.229 bits (404), Expect = 3.689e-47
Identity = 77/130 (59.23%), Postives = 95/130 (73.08%), Query Frame = -3
Query:  190 MFSKTWKPKKTGVIKGPTIFSDDPVRRSANHSEQREKLGLNSAPKGQSNPRRAISEPTNAFERVEVEKGKQDDALSDISDLLGELKGMAIDMGSEIDKQTKAIDGFEKDTEKLNDRMNGANRHTRHLLGK 579
            MFSKTWKPKKT  I GP +  DD   R  NH E+REKLGLNSAP+GQS  R  + E  +A++RVE+EK KQDD LSD+SD+LGELK MA+DMGSEI+KQ K +D    D ++LN R+  +N+  R LLGK
Sbjct:  171 MFSKTWKPKKTRPINGPVVTRDDSPTRRVNHLEKREKLGLNSAPRGQSRTREPLPESADAYQRVEMEKAKQDDGLSDLSDILGELKNMAVDMGSEIEKQNKGLDHLHDDVDELNFRVQQSNQRGRRLLGK 300          

HSP 2 Score: 49.6766 bits (117), Expect = 3.689e-47
Identity = 27/43 (62.79%), Postives = 30/43 (69.77%), Query Frame = -1
Query:  603 SEDSGGDARGGFQTLVMLHHPGEQITRSHDIAAGIDHDLSRGE 731
            +ED   DA    +TLVMLH  GEQITR+H  A  IDHDLSRGE
Sbjct:  123 AEDIRSDAT---RTLVMLHDQGEQITRTHHKAVEIDHDLSRGE 162          
BLAST of CD858891 vs. SwissProt
Match: SNP30_ARATH (Putative SNAP25 homologous protein SNAP30 OS=Arabidopsis thaliana GN=SNAP30 PE=2 SV=1)

HSP 1 Score: 157.918 bits (398), Expect = 5.664e-45
Identity = 77/130 (59.23%), Postives = 97/130 (74.62%), Query Frame = -3
Query:  190 MFSKTWKPKKTGVIKGPTIFSDDPVRRSANHSEQREKLGLNSAPKGQSNPRRAISEPTNAFERVEVEKGKQDDALSDISDLLGELKGMAIDMGSEIDKQTKAIDGFEKDTEKLNDRMNGANRHTRHLLGK 579
            MFSK WKPKKT  I GP I  D P ++S NH E+REKLGL +  KG+S+ + A+ +PTNA ++VE EK KQDD LSD+SD+LG+LK MA+DMGSEIDKQ KA+D    D ++LN R+ GAN+  RHLL K
Sbjct:  136 MFSKPWKPKKTKNITGPMITPDKPSKKSENHKEEREKLGLGA--KGRSSSQPALDQPTNALQKVEQEKAKQDDGLSDLSDILGDLKSMAVDMGSEIDKQNKALDHLGDDVDELNSRVQGANQRARHLLSK 263          

HSP 2 Score: 44.669 bits (104), Expect = 5.664e-45
Identity = 20/33 (60.61%), Postives = 25/33 (75.76%), Query Frame = -1
Query:  603 GFQTLVMLHHPGEQITRSHDIAAGIDHDLSRGE 701
            G +TL MLH  GEQI R+H++A  +D DLSRGE
Sbjct:   95 GARTLEMLHQQGEQINRTHEMAVDMDKDLSRGE 127          
BLAST of CD858891 vs. SwissProt
Match: SNP29_ARATH (SNAP25 homologous protein SNAP29 OS=Arabidopsis thaliana GN=SNAP29 PE=2 SV=1)

HSP 1 Score: 106.686 bits (265), Expect = 1.487e-28
Identity = 55/130 (42.31%), Postives = 86/130 (66.15%), Query Frame = -3
Query:  190 MFSKTWKPKKTGVIKGPTIFSDDPVRRSANHSEQREKLGLNSAPKGQSNPRRAISEPTNAFERVEVEKGKQDDALSDISDLLGELKGMAIDMGSEIDKQTKAIDGFEKDTEKLNDRMNGANRHTRHLLGK 579
            +FS+TWKPKK+  I GP I   D  +R     + REKLGLN + K +S   + + E  +A+++ ++   KQD+AL+D+S LLGELK MA+DMG+ I++QT  +D  + + ++LN R+  +N+  R+LL K
Sbjct:  127 VFSRTWKPKKSRSITGPVITKGDSPKRKVIDLKTREKLGLNPSLKPKS---KTLPEAVDAYQKTQI--AKQDEALTDLSALLGELKNMAVDMGTAIERQTNELDHLQDNADELNYRVKQSNQRARYLLRK 251          

HSP 2 Score: 40.817 bits (94), Expect = 1.487e-28
Identity = 18/31 (58.06%), Postives = 23/31 (74.19%), Query Frame = -1
Query:  603 QTLVMLHHPGEQITRSHDIAAGIDHDLSRGE 695
            +TLVML+  G+QITR+H     +DH LSRGE
Sbjct:   88 KTLVMLNEQGDQITRTHQKTVDLDHHLSRGE 118          
BLAST of CD858891 vs. TAIR peptide
Match: AT5G61210.1 (| Symbols: SNAP33, ATSNAP33, SNP33, ATSNAP33B | soluble N-ethylmaleimide-sensitive factor adaptor protein 33 | chr5:24624027-24625366 FORWARD LENGTH=300)

HSP 1 Score: 160.229 bits (404), Expect = 3.672e-48
Identity = 77/130 (59.23%), Postives = 95/130 (73.08%), Query Frame = -3
Query:  190 MFSKTWKPKKTGVIKGPTIFSDDPVRRSANHSEQREKLGLNSAPKGQSNPRRAISEPTNAFERVEVEKGKQDDALSDISDLLGELKGMAIDMGSEIDKQTKAIDGFEKDTEKLNDRMNGANRHTRHLLGK 579
            MFSKTWKPKKT  I GP +  DD   R  NH E+REKLGLNSAP+GQS  R  + E  +A++RVE+EK KQDD LSD+SD+LGELK MA+DMGSEI+KQ K +D    D ++LN R+  +N+  R LLGK
Sbjct:  171 MFSKTWKPKKTRPINGPVVTRDDSPTRRVNHLEKREKLGLNSAPRGQSRTREPLPESADAYQRVEMEKAKQDDGLSDLSDILGELKNMAVDMGSEIEKQNKGLDHLHDDVDELNFRVQQSNQRGRRLLGK 300          

HSP 2 Score: 49.6766 bits (117), Expect = 3.672e-48
Identity = 27/43 (62.79%), Postives = 30/43 (69.77%), Query Frame = -1
Query:  603 SEDSGGDARGGFQTLVMLHHPGEQITRSHDIAAGIDHDLSRGE 731
            +ED   DA    +TLVMLH  GEQITR+H  A  IDHDLSRGE
Sbjct:  123 AEDIRSDAT---RTLVMLHDQGEQITRTHHKAVEIDHDLSRGE 162          
BLAST of CD858891 vs. TAIR peptide
Match: AT1G13890.1 (| Symbols: SNAP30, ATSNAP30 | soluble N-ethylmaleimide-sensitive factor adaptor protein 30 | chr1:4751581-4752844 FORWARD LENGTH=263)

HSP 1 Score: 157.918 bits (398), Expect = 5.637e-46
Identity = 77/130 (59.23%), Postives = 97/130 (74.62%), Query Frame = -3
Query:  190 MFSKTWKPKKTGVIKGPTIFSDDPVRRSANHSEQREKLGLNSAPKGQSNPRRAISEPTNAFERVEVEKGKQDDALSDISDLLGELKGMAIDMGSEIDKQTKAIDGFEKDTEKLNDRMNGANRHTRHLLGK 579
            MFSK WKPKKT  I GP I  D P ++S NH E+REKLGL +  KG+S+ + A+ +PTNA ++VE EK KQDD LSD+SD+LG+LK MA+DMGSEIDKQ KA+D    D ++LN R+ GAN+  RHLL K
Sbjct:  136 MFSKPWKPKKTKNITGPMITPDKPSKKSENHKEEREKLGLGA--KGRSSSQPALDQPTNALQKVEQEKAKQDDGLSDLSDILGDLKSMAVDMGSEIDKQNKALDHLGDDVDELNSRVQGANQRARHLLSK 263          

HSP 2 Score: 44.669 bits (104), Expect = 5.637e-46
Identity = 20/33 (60.61%), Postives = 25/33 (75.76%), Query Frame = -1
Query:  603 GFQTLVMLHHPGEQITRSHDIAAGIDHDLSRGE 701
            G +TL MLH  GEQI R+H++A  +D DLSRGE
Sbjct:   95 GARTLEMLHQQGEQINRTHEMAVDMDKDLSRGE 127          
BLAST of CD858891 vs. TAIR peptide
Match: AT5G07880.1 (| Symbols: SNAP29, ATSNAP29 | synaptosomal-associated protein SNAP25-like 29 | chr5:2515587-2516694 REVERSE LENGTH=251)

HSP 1 Score: 106.686 bits (265), Expect = 1.479e-29
Identity = 55/130 (42.31%), Postives = 86/130 (66.15%), Query Frame = -3
Query:  190 MFSKTWKPKKTGVIKGPTIFSDDPVRRSANHSEQREKLGLNSAPKGQSNPRRAISEPTNAFERVEVEKGKQDDALSDISDLLGELKGMAIDMGSEIDKQTKAIDGFEKDTEKLNDRMNGANRHTRHLLGK 579
            +FS+TWKPKK+  I GP I   D  +R     + REKLGLN + K +S   + + E  +A+++ ++   KQD+AL+D+S LLGELK MA+DMG+ I++QT  +D  + + ++LN R+  +N+  R+LL K
Sbjct:  127 VFSRTWKPKKSRSITGPVITKGDSPKRKVIDLKTREKLGLNPSLKPKS---KTLPEAVDAYQKTQI--AKQDEALTDLSALLGELKNMAVDMGTAIERQTNELDHLQDNADELNYRVKQSNQRARYLLRK 251          

HSP 2 Score: 40.817 bits (94), Expect = 1.479e-29
Identity = 18/31 (58.06%), Postives = 23/31 (74.19%), Query Frame = -1
Query:  603 QTLVMLHHPGEQITRSHDIAAGIDHDLSRGE 695
            +TLVML+  G+QITR+H     +DH LSRGE
Sbjct:   88 KTLVMLNEQGDQITRTHQKTVDLDHHLSRGE 118          
The following BLAST results are available for this feature:
Homology Analysis: Pisum sativum unigene v1 vs Trembl
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Trembl)
Total hits: 10
Match NameE-valueIdentityDescription
C6T858_SOYBN1.217e-6073.85Putative uncharacterized protein OS=Glycine max PE... [more]
C6T803_SOYBN3.095e-5872.31Putative uncharacterized protein OS=Glycine max PE... [more]
C6TJG5_SOYBN2.007e-5268.46Putative uncharacterized protein OS=Glycine max PE... [more]
B9IE11_POPTR1.345e-4760.77Predicted protein OS=Populus trichocarpa GN=POPTRD... [more]
B9RLS5_RICCO3.160e-4661.54Synaptosomal associated protein, putative OS=Ricin... [more]
D7MUI6_ARALY7.909e-4560.00Synaptosomal-associated protein 33 OS=Arabidopsis ... [more]
B9I2W3_POPTR8.574e-4456.92Predicted protein OS=Populus trichocarpa GN=POPTRD... [more]
D7KQK9_ARALY4.561e-4257.69Synaptosomal-associated protein 30 OS=Arabidopsis ... [more]
B9RCW1_RICCO2.916e-4156.92Synaptosomal associated protein, putative OS=Ricin... [more]
Q6X9T4_HORVD2.412e-4058.46SNAP-34 OS=Hordeum vulgare var. distichum PE=2 SV=... [more]
back to top
Homology Analysis: Pisum sativum unigene v1 vs Swissprot
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Swissprot)
Total hits: 3
Match NameE-valueIdentityDescription
SNP33_ARATH3.689e-4759.23SNAP25 homologous protein SNAP33 OS=Arabidopsis th... [more]
SNP30_ARATH5.664e-4559.23Putative SNAP25 homologous protein SNAP30 OS=Arabi... [more]
SNP29_ARATH1.487e-2842.31SNAP25 homologous protein SNAP29 OS=Arabidopsis th... [more]
back to top
Homology Analysis: Pisum sativum unigene v1 vs TAIR 10 peptide
Analysis Date: 2011-02-03 (Homology Analysis: Pisum sativum unigene v1 vs TAIR 10 peptide)
Total hits: 3
Match NameE-valueIdentityDescription
AT5G61210.13.672e-4859.23| Symbols: SNAP33, ATSNAP33, SNP33, ATSNAP33B | so... [more]
AT1G13890.15.637e-4659.23| Symbols: SNAP30, ATSNAP30 | soluble N-ethylmalei... [more]
AT5G07880.11.479e-2942.31| Symbols: SNAP29, ATSNAP29 | synaptosomal-associa... [more]
back to top
InterPro
Analysis Name: InterProScan analysis for Pisum sativum unigene v1
Date Performed: 2010-12-29
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableSEGsegsegcoord: 11..22
score
NoneNo IPR availableSEGsegsegcoord: 27..38
score
NoneNo IPR availableGENE3D1.20.5.110no descriptioncoord: 81..142
score: 3.3
NoneNo IPR availablePANTHERPTHR19305SYNAPTOSOMAL ASSOCIATED PROTEINcoord: 2..143
score: 1.9
NoneNo IPR availableSEGsegsegcoord: 2..13
score
IPR000727Target SNARE coiled-coil domainPFAMPF05739SNAREcoord: 83..141
score: 1.5
IPR000727Target SNARE coiled-coil domainSMARTSM00397no descriptioncoord: 73..140
score: 3.9
IPR000727Target SNARE coiled-coil domainPROFILEPS50192T_SNAREcoord: 78..140
score: 14

Properties
Property NameValue
Singlet in analysisPisum sativum unigene v1
Sequences
The following sequences are available for this feature:

EST sequence

>CD858891 ID=CD858891|Name=CD858891|organism=Pisum sativum|type=EST|length=734bp
GGTAATAATCATGGATAAACCCAAATCAATATCAATATACAATATATTTC
AAGAAAAAGAAGTTATTTTCACAAGTGGATTATACATAAAATGAAACTAG
TGTTTTTTATAAGGTTGGAATCTCCAATCAAATAATGAAAAGTAGCAAAA
GTTTGAATCAATCTGATGAAATGATGATATGCATCCCTATTTTCCAAGTA
AATGACGAGTGTGTCGATTGGCGCCATTCATGCGGTCGTTCAACTTCTCG
GTATCCTTTTCAAATCCATCTATGGCTTTGGTTTGCTTGTCAATTTCAGA
TCCCATGTCAATGGCCATGCCTTTAAGTTCTCCCAACAAATCACTTATAT
CAGATAGTGCATCATCTTGCTTCCCTTTCTCAACCTCGACTCTTTCAAAT
GCATTAGTTGGCTCCGAAATGGCTCTTCTTGGGTTTGACTGTCCTTTAGG
GGCAGAATTCAATCCCAACTTCTCTCGTTGCTCAGAGTGGTTGGCGCTTC
TTCGGACCGGATCATCGGAAAATATGGTTGGGCCTTTTATTACGCCGGTC
TTCTTCGGTTTCCATGTTTTGGAGAACATGCCACCAAGACTTCCCAAAAG
CTTTCTCCCCGACTTAAATCATGGTCAATGCCAGCAGCAATATCGTGACT
CCTTGTAATCTGCTCGCCTGGATGATGCAACATAACCAAAGTCTGGAAGC
CTCCTCTCGCATCTCCTCCGCTATCTTCCGAAAA
back to top
Annotated Terms
The following terms have been associated with this EST:
Vocabulary: INTERPRO
TermDefinition
IPR000727T_SNARE_dom