CD860474

EST Overview
NameCD860474
Unique NameCD860474
TypeEST
OrganismPisum sativum (pea)
Sequence length485
Libraries
Library NameType
LIBEST_014003 TEcdna_library
Unigenes
This EST is part of the following unigenes:
Unigene NameAnalysis NameSequence type in Unigene
Pisum sativum unigene v2Pisum sativum unigene v2EST
Pisum sativum unigene v1Pisum sativum unigene v1EST
Homology
BLAST of CD860474 vs. TrEMBL
Match: B9SJ73_RICCO (Smg-7, putative OS=Ricinus communis GN=RCOM_1478200 PE=4 SV=1)

HSP 1 Score: 113.235 bits (282), Expect = 8.508e-24
Identity = 69/153 (45.10%), Postives = 88/153 (57.52%), Query Frame = 1
Query:   37 FYGLPKTEDSMIPSKVDTVASSGVITDNSYVKSLSVSQADLRKXXXXXXXXXXXXXXGFSHVSPRLDMESTV-SDSISGNPVMDDYSWLDGYQLPASTKGSGPDGPIAYT-QSNSHLVNHNIS-SGAVCFPFPGKQVPSA-LQGVKQNGWQDY 483
            FY   K  +S++PS VD + +SGV+ ++  VK+     A +RK              GFSHV P+   E    SD +SGN + DDYSWLDGYQL +STKGSG +    +T Q+    +N N    G V FPFPGKQVPS   Q  KQNGWQ+Y
Sbjct:  787 FYNQTKMLESVVPSNVDVI-TSGVLAESLAVKTSMALPAGMRKSPVSRPVRHLGPPPGFSHVPPKQFNEPVSGSDLMSGNSLADDYSWLDGYQLSSSTKGSGLNTAANFTSQAMPQYINSNNGLMGTVSFPFPGKQVPSVQFQTEKQNGWQNY 938          
BLAST of CD860474 vs. TrEMBL
Match: B9GG80_POPTR (Predicted protein (Fragment) OS=Populus trichocarpa GN=POPTRDRAFT_706531 PE=4 SV=1)

HSP 1 Score: 101.679 bits (252), Expect = 2.562e-20
Identity = 66/159 (41.51%), Postives = 85/159 (53.46%), Query Frame = 1
Query:   28 TKSFYGLPKTEDSMIPSKVDTVASSGVITDNSYVKSLSVSQADLRKXXXXXXXXXXXXXXGFSHVSPRLDMESTVSDSI--SGNPVMDDYSWLDGYQLPASTKGSGPDGPIAYTQSNSHLVNHNIS--SGAVCFPFPGKQVPSALQGVKQ---NGWQDY 483
            T  FYG  K  ++ +PSKVDT A SGVI ++  VK+ +     LRK              GF+ V P+   E  VS S+  + NP+ DDYSWLDGYQLP+S K SG +G    T   +   + N S  SG   FPFPGKQVP     ++Q   NG Q +
Sbjct:  473 TGMFYGQTKVAETAVPSKVDTYAPSGVIAESLAVKTSAALPPGLRKSPVSRPLRHLGPPPGFNSVPPKQASEP-VSGSVLMAENPLQDDYSWLDGYQLPSSAKVSGLNGSANVTSHAAPQYSSNSSGLSGTASFPFPGKQVPPQEHQLQQQLINGNQQF 630          
BLAST of CD860474 vs. TrEMBL
Match: D7TIP2_VITVI (Whole genome shotgun sequence of line PN40024, scaffold_7.assembly12x (Fragment) OS=Vitis vinifera GN=VIT_00033622001 PE=4 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 4.679e-14
Identity = 53/135 (39.26%), Postives = 71/135 (52.59%), Query Frame = 1
Query:   61 DSMIPSKVDTVASSGVITDNSYVKSLSVSQADLRKXXXXXXXXXXXXXXGFSHVSPRLDMESTVSDSISG------NPVMDDYSWLDGYQLPASTKGSGPDGPIAYT-QSNSHLVNHNISSGAVCFPFPGKQVPS 444
            +++IPSK D++  SG  +D   +K  S S A  RK              GFS V P+      V +  SG      N V+DDYSWLDGYQLP+ST+G G    I ++ Q+  +    N  +G   FPFPGKQVP+
Sbjct:  794 ETVIPSKFDSIMLSGASSDGLSMKPSSASSAISRKNPVSRPVRHSGPPPGFSPVPPK-----NVEEPFSGLNLKNENLVVDDYSWLDGYQLPSSTQGIGFSHSINHSAQAYQNESKINSLNGTQNFPFPGKQVPT 923          
BLAST of CD860474 vs. TrEMBL
Match: D7LZ76_ARALY (Putative uncharacterized protein OS=Arabidopsis lyrata subsp. lyrata GN=ARALYDRAFT_488829 PE=4 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 7.982e-14
Identity = 51/142 (35.92%), Postives = 73/142 (51.41%), Query Frame = 1
Query:   40 YGLPKTEDSMIPSKVDTVASSGVITDNSYVKSLSVSQADLRKXXXXXXXXXXXXXXGFSHVSPRLDMESTVSDSISGN---PVMDDYSWLDGYQLPASTKGSGPDGPIAYTQSN--SHL-VNHNISSGAVCFPFPGKQVPSA 447
            Y   +T ++++  K+DTV S+GV+ D      L V  +  +K              GF+ V  +L  E       SGN   PV DDYSWLDGYQ   S++G+GP+  + Y  S    H+    N+ +G   FPFPGKQVP++
Sbjct:  870 YSQSRTSEAVLTPKIDTVLSAGVVADG-----LGVQSSLAKKNPISRAIRHLGPPPGFNSVPSKLQKEPAPGSDFSGNNNLPV-DDYSWLDGYQ-AQSSRGAGPNSSLNYAASGKPEHMGGTSNVLNGVANFPFPGKQVPTS 1004          
BLAST of CD860474 vs. TrEMBL
Match: Q3E7L8_ARATH (Putative uncharacterized protein At5g19400.1 OS=Arabidopsis thaliana GN=SMG7 PE=2 SV=2)

HSP 1 Score: 74.3294 bits (181), Expect = 4.380e-12
Identity = 52/142 (36.62%), Postives = 70/142 (49.30%), Query Frame = 1
Query:   40 YGLPKTEDSMIPSKVDTVASSGVITDNSYVKSLSVSQADLRKXXXXXXXXXXXXXXGFSHVSPRLDMESTVSDSISGN---PVMDDYSWLDGYQLPASTKGSGPDGPIAYTQSN--SHL-VNHNISSGAVCFPFPGKQVPSA 447
            Y   +T +++ P K+D V SSGV+ D      L V  +  +K              GF+ V  +L  E      +SGN   PV DDYSWLDGYQ   S++G G +  + Y  S    HL    N  +G   FPFPGKQVP++
Sbjct:  882 YSQSRTPEAVFPPKIDPVLSSGVVAD-----GLGVQSSLAKKNPISRAFRHLGPPPGFNSVPAKLQKEPAPGSELSGNNHLPV-DDYSWLDGYQ-AQSSRGVGLNSSLNYATSGKPEHLGSTGNGLNGPANFPFPGKQVPTS 1016          
BLAST of CD860474 vs. TrEMBL
Match: Q8W417_TOBAC (Cig3 OS=Nicotiana tabacum GN=cig3 PE=2 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 5.354e-10
Identity = 43/131 (32.82%), Postives = 68/131 (51.91%), Query Frame = 1
Query:   61 DSMIPSKVDTVASSGVITDNSYVKSLSVSQADLRKXXXXXXXXXXXXXXGFSHVSPRLD-MESTVSDSISGNPV--MDDYSWLDGYQLPASTKGSGPDGPIAYTQSNSHLVNHNIS-SGAVCFPFPGKQVP 441
            ++ IPS   ++ SS   + +  +KS SV    ++K              GF   + ++D   S ++     NP+  MDDYSWL+GYQLP++ +  G +    ++    H V+++ S  G V FPFPGKQVP
Sbjct:  673 EAAIPSTFSSLTSSVAGSGSMSMKSSSVISTGMKKNPVSRPVRHLGPPPGFGSAASKVDDSSSALTLRNENNPISRMDDYSWLNGYQLPSTHQSIGYNNSHNHSTQTYHSVSNSGSLVGVVSFPFPGKQVP 803          
BLAST of CD860474 vs. TrEMBL
Match: B9H8U5_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_560381 PE=4 SV=1)

HSP 1 Score: 59.6918 bits (143), Expect = 1.116e-7
Identity = 46/143 (32.17%), Postives = 65/143 (45.45%), Query Frame = 1
Query:   52 KTEDSMIPSKVDTVASSGVITDNSYVKSLSVSQADLRKXXXXXXXXXXXXXXGFSHVSPRLDMESTVSDSISGNPV-MDDYSWLDGYQLPASTKGSGPDGPIAYTQSNSHLVNHNIS-SGAVCFPFPGKQVPSALQGVK-QNG 471
            K  D+++  K + V SS    D+  +K+ SV  A  R               GFS V P+   E             MDDYSWLDGYQ P+S K +  +  I + + + H    N   +G   FPFPGKQ+ +    ++ QNG
Sbjct:  787 KVPDTVVHLKSEPVMSSVSGFDSLSLKASSVFPASSRLNPVSRPVHHLGPPPGFSSVPPKAKCEILSGIGQENYDFHMDDYSWLDGYQPPSSAKATVFNNSINHPEQSCHHTTANDGLTGTRMFPFPGKQLQTFPMKIESQNG 929          
BLAST of CD860474 vs. TAIR peptide
Match: AT5G19400.2 (| Symbols: SMG7 | Telomerase activating protein Est1 | chr5:6540603-6544262 FORWARD LENGTH=1059)

HSP 1 Score: 74.3294 bits (181), Expect = 3.627e-14
Identity = 52/142 (36.62%), Postives = 70/142 (49.30%), Query Frame = 1
Query:   40 YGLPKTEDSMIPSKVDTVASSGVITDNSYVKSLSVSQADLRKXXXXXXXXXXXXXXGFSHVSPRLDMESTVSDSISGN---PVMDDYSWLDGYQLPASTKGSGPDGPIAYTQSN--SHL-VNHNISSGAVCFPFPGKQVPSA 447
            Y   +T +++ P K+D V SSGV+ D      L V  +  +K              GF+ V  +L  E      +SGN   PV DDYSWLDGYQ   S++G G +  + Y  S    HL    N  +G   FPFPGKQVP++
Sbjct:  882 YSQSRTPEAVFPPKIDPVLSSGVVAD-----GLGVQSSLAKKNPISRAFRHLGPPPGFNSVPAKLQKEPAPGSELSGNNHLPV-DDYSWLDGYQ-AQSSRGVGLNSSLNYATSGKPEHLGSTGNGLNGPANFPFPGKQVPTS 1016          
BLAST of CD860474 vs. TAIR peptide
Match: AT5G19400.3 (| Symbols: SMG7 | Telomerase activating protein Est1 | chr5:6540603-6544262 FORWARD LENGTH=1059)

HSP 1 Score: 74.3294 bits (181), Expect = 3.627e-14
Identity = 52/142 (36.62%), Postives = 70/142 (49.30%), Query Frame = 1
Query:   40 YGLPKTEDSMIPSKVDTVASSGVITDNSYVKSLSVSQADLRKXXXXXXXXXXXXXXGFSHVSPRLDMESTVSDSISGN---PVMDDYSWLDGYQLPASTKGSGPDGPIAYTQSN--SHL-VNHNISSGAVCFPFPGKQVPSA 447
            Y   +T +++ P K+D V SSGV+ D      L V  +  +K              GF+ V  +L  E      +SGN   PV DDYSWLDGYQ   S++G G +  + Y  S    HL    N  +G   FPFPGKQVP++
Sbjct:  882 YSQSRTPEAVFPPKIDPVLSSGVVAD-----GLGVQSSLAKKNPISRAFRHLGPPPGFNSVPAKLQKEPAPGSELSGNNHLPV-DDYSWLDGYQ-AQSSRGVGLNSSLNYATSGKPEHLGSTGNGLNGPANFPFPGKQVPTS 1016          
BLAST of CD860474 vs. TAIR peptide
Match: AT5G19400.1 (| Symbols: SMG7 | Telomerase activating protein Est1 | chr5:6540603-6544262 FORWARD LENGTH=1059)

HSP 1 Score: 74.3294 bits (181), Expect = 3.627e-14
Identity = 52/142 (36.62%), Postives = 70/142 (49.30%), Query Frame = 1
Query:   40 YGLPKTEDSMIPSKVDTVASSGVITDNSYVKSLSVSQADLRKXXXXXXXXXXXXXXGFSHVSPRLDMESTVSDSISGN---PVMDDYSWLDGYQLPASTKGSGPDGPIAYTQSN--SHL-VNHNISSGAVCFPFPGKQVPSA 447
            Y   +T +++ P K+D V SSGV+ D      L V  +  +K              GF+ V  +L  E      +SGN   PV DDYSWLDGYQ   S++G G +  + Y  S    HL    N  +G   FPFPGKQVP++
Sbjct:  882 YSQSRTPEAVFPPKIDPVLSSGVVAD-----GLGVQSSLAKKNPISRAFRHLGPPPGFNSVPAKLQKEPAPGSELSGNNHLPV-DDYSWLDGYQ-AQSSRGVGLNSSLNYATSGKPEHLGSTGNGLNGPANFPFPGKQVPTS 1016          
BLAST of CD860474 vs. TAIR peptide
Match: AT5G19400.2 (| Symbols: SMG7 | Telomerase activating protein Est1 | chr5:6540603-6544262 FORWARD LENGTH=1059)

HSP 1 Score: 74.3294 bits (181), Expect = 3.627e-14
Identity = 52/142 (36.62%), Postives = 70/142 (49.30%), Query Frame = 1
Query:   40 YGLPKTEDSMIPSKVDTVASSGVITDNSYVKSLSVSQADLRKXXXXXXXXXXXXXXGFSHVSPRLDMESTVSDSISGN---PVMDDYSWLDGYQLPASTKGSGPDGPIAYTQSN--SHL-VNHNISSGAVCFPFPGKQVPSA 447
            Y   +T +++ P K+D V SSGV+ D      L V  +  +K              GF+ V  +L  E      +SGN   PV DDYSWLDGYQ   S++G G +  + Y  S    HL    N  +G   FPFPGKQVP++
Sbjct:  882 YSQSRTPEAVFPPKIDPVLSSGVVAD-----GLGVQSSLAKKNPISRAFRHLGPPPGFNSVPAKLQKEPAPGSELSGNNHLPV-DDYSWLDGYQ-AQSSRGVGLNSSLNYATSGKPEHLGSTGNGLNGPANFPFPGKQVPTS 1016          
BLAST of CD860474 vs. TAIR peptide
Match: AT5G19400.3 (| Symbols: SMG7 | Telomerase activating protein Est1 | chr5:6540603-6544262 FORWARD LENGTH=1059)

HSP 1 Score: 74.3294 bits (181), Expect = 3.627e-14
Identity = 52/142 (36.62%), Postives = 70/142 (49.30%), Query Frame = 1
Query:   40 YGLPKTEDSMIPSKVDTVASSGVITDNSYVKSLSVSQADLRKXXXXXXXXXXXXXXGFSHVSPRLDMESTVSDSISGN---PVMDDYSWLDGYQLPASTKGSGPDGPIAYTQSN--SHL-VNHNISSGAVCFPFPGKQVPSA 447
            Y   +T +++ P K+D V SSGV+ D      L V  +  +K              GF+ V  +L  E      +SGN   PV DDYSWLDGYQ   S++G G +  + Y  S    HL    N  +G   FPFPGKQVP++
Sbjct:  882 YSQSRTPEAVFPPKIDPVLSSGVVAD-----GLGVQSSLAKKNPISRAFRHLGPPPGFNSVPAKLQKEPAPGSELSGNNHLPV-DDYSWLDGYQ-AQSSRGVGLNSSLNYATSGKPEHLGSTGNGLNGPANFPFPGKQVPTS 1016          
BLAST of CD860474 vs. TAIR peptide
Match: AT5G19400.1 (| Symbols: SMG7 | Telomerase activating protein Est1 | chr5:6540603-6544262 FORWARD LENGTH=1059)

HSP 1 Score: 74.3294 bits (181), Expect = 3.627e-14
Identity = 52/142 (36.62%), Postives = 70/142 (49.30%), Query Frame = 1
Query:   40 YGLPKTEDSMIPSKVDTVASSGVITDNSYVKSLSVSQADLRKXXXXXXXXXXXXXXGFSHVSPRLDMESTVSDSISGN---PVMDDYSWLDGYQLPASTKGSGPDGPIAYTQSN--SHL-VNHNISSGAVCFPFPGKQVPSA 447
            Y   +T +++ P K+D V SSGV+ D      L V  +  +K              GF+ V  +L  E      +SGN   PV DDYSWLDGYQ   S++G G +  + Y  S    HL    N  +G   FPFPGKQVP++
Sbjct:  882 YSQSRTPEAVFPPKIDPVLSSGVVAD-----GLGVQSSLAKKNPISRAFRHLGPPPGFNSVPAKLQKEPAPGSELSGNNHLPV-DDYSWLDGYQ-AQSSRGVGLNSSLNYATSGKPEHLGSTGNGLNGPANFPFPGKQVPTS 1016          
BLAST of CD860474 vs. TrEMBL
Match: B9SJ73_RICCO (Smg-7, putative OS=Ricinus communis GN=RCOM_1478200 PE=4 SV=1)

HSP 1 Score: 113.235 bits (282), Expect = 1.064e-23
Identity = 69/153 (45.10%), Postives = 88/153 (57.52%), Query Frame = 1
Query:   37 FYGLPKTEDSMIPSKVDTVASSGVITDNSYVKSLSVSQADLRKXXXXXXXXXXXXXXGFSHVSPRLDMESTV-SDSISGNPVMDDYSWLDGYQLPASTKGSGPDGPIAYT-QSNSHLVNHNIS-SGAVCFPFPGKQVPSA-LQGVKQNGWQDY 483
            FY   K  +S++PS VD + +SGV+ ++  VK+     A +RK              GFSHV P+   E    SD +SGN + DDYSWLDGYQL +STKGSG +    +T Q+    +N N    G V FPFPGKQVPS   Q  KQNGWQ+Y
Sbjct:  787 FYNQTKMLESVVPSNVDVI-TSGVLAESLAVKTSMALPAGMRKSPVSRPVRHLGPPPGFSHVPPKQFNEPVSGSDLMSGNSLADDYSWLDGYQLSSSTKGSGLNTAANFTSQAMPQYINSNNGLMGTVSFPFPGKQVPSVQFQTEKQNGWQNY 938          
BLAST of CD860474 vs. TrEMBL
Match: B9GG80_POPTR (Predicted protein (Fragment) OS=Populus trichocarpa GN=POPTRDRAFT_706531 PE=4 SV=1)

HSP 1 Score: 101.679 bits (252), Expect = 3.203e-20
Identity = 66/159 (41.51%), Postives = 85/159 (53.46%), Query Frame = 1
Query:   28 TKSFYGLPKTEDSMIPSKVDTVASSGVITDNSYVKSLSVSQADLRKXXXXXXXXXXXXXXGFSHVSPRLDMESTVSDSI--SGNPVMDDYSWLDGYQLPASTKGSGPDGPIAYTQSNSHLVNHNIS--SGAVCFPFPGKQVPSALQGVKQ---NGWQDY 483
            T  FYG  K  ++ +PSKVDT A SGVI ++  VK+ +     LRK              GF+ V P+   E  VS S+  + NP+ DDYSWLDGYQLP+S K SG +G    T   +   + N S  SG   FPFPGKQVP     ++Q   NG Q +
Sbjct:  473 TGMFYGQTKVAETAVPSKVDTYAPSGVIAESLAVKTSAALPPGLRKSPVSRPLRHLGPPPGFNSVPPKQASEP-VSGSVLMAENPLQDDYSWLDGYQLPSSAKVSGLNGSANVTSHAAPQYSSNSSGLSGTASFPFPGKQVPPQEHQLQQQLINGNQQF 630          
BLAST of CD860474 vs. TrEMBL
Match: D7TIP2_VITVI (Whole genome shotgun sequence of line PN40024, scaffold_7.assembly12x (Fragment) OS=Vitis vinifera GN=VIT_00033622001 PE=4 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 5.851e-14
Identity = 53/135 (39.26%), Postives = 71/135 (52.59%), Query Frame = 1
Query:   61 DSMIPSKVDTVASSGVITDNSYVKSLSVSQADLRKXXXXXXXXXXXXXXGFSHVSPRLDMESTVSDSISG------NPVMDDYSWLDGYQLPASTKGSGPDGPIAYT-QSNSHLVNHNISSGAVCFPFPGKQVPS 444
            +++IPSK D++  SG  +D   +K  S S A  RK              GFS V P+      V +  SG      N V+DDYSWLDGYQLP+ST+G G    I ++ Q+  +    N  +G   FPFPGKQVP+
Sbjct:  794 ETVIPSKFDSIMLSGASSDGLSMKPSSASSAISRKNPVSRPVRHSGPPPGFSPVPPK-----NVEEPFSGLNLKNENLVVDDYSWLDGYQLPSSTQGIGFSHSINHSAQAYQNESKINSLNGTQNFPFPGKQVPT 923          
BLAST of CD860474 vs. TrEMBL
Match: D7LZ76_ARALY (Putative uncharacterized protein OS=Arabidopsis lyrata subsp. lyrata GN=ARALYDRAFT_488829 PE=4 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 9.981e-14
Identity = 51/142 (35.92%), Postives = 73/142 (51.41%), Query Frame = 1
Query:   40 YGLPKTEDSMIPSKVDTVASSGVITDNSYVKSLSVSQADLRKXXXXXXXXXXXXXXGFSHVSPRLDMESTVSDSISGN---PVMDDYSWLDGYQLPASTKGSGPDGPIAYTQSN--SHL-VNHNISSGAVCFPFPGKQVPSA 447
            Y   +T ++++  K+DTV S+GV+ D      L V  +  +K              GF+ V  +L  E       SGN   PV DDYSWLDGYQ   S++G+GP+  + Y  S    H+    N+ +G   FPFPGKQVP++
Sbjct:  870 YSQSRTSEAVLTPKIDTVLSAGVVADG-----LGVQSSLAKKNPISRAIRHLGPPPGFNSVPSKLQKEPAPGSDFSGNNNLPV-DDYSWLDGYQ-AQSSRGAGPNSSLNYAASGKPEHMGGTSNVLNGVANFPFPGKQVPTS 1004          
BLAST of CD860474 vs. TrEMBL
Match: Q3E7L8_ARATH (SMG7-like protein OS=Arabidopsis thaliana GN=SMG7 PE=2 SV=2)

HSP 1 Score: 74.3294 bits (181), Expect = 5.477e-12
Identity = 52/142 (36.62%), Postives = 70/142 (49.30%), Query Frame = 1
Query:   40 YGLPKTEDSMIPSKVDTVASSGVITDNSYVKSLSVSQADLRKXXXXXXXXXXXXXXGFSHVSPRLDMESTVSDSISGN---PVMDDYSWLDGYQLPASTKGSGPDGPIAYTQSN--SHL-VNHNISSGAVCFPFPGKQVPSA 447
            Y   +T +++ P K+D V SSGV+ D      L V  +  +K              GF+ V  +L  E      +SGN   PV DDYSWLDGYQ   S++G G +  + Y  S    HL    N  +G   FPFPGKQVP++
Sbjct:  882 YSQSRTPEAVFPPKIDPVLSSGVVAD-----GLGVQSSLAKKNPISRAFRHLGPPPGFNSVPAKLQKEPAPGSELSGNNHLPV-DDYSWLDGYQ-AQSSRGVGLNSSLNYATSGKPEHLGSTGNGLNGPANFPFPGKQVPTS 1016          
BLAST of CD860474 vs. TrEMBL
Match: Q8W417_TOBAC (Cig3 OS=Nicotiana tabacum GN=cig3 PE=2 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 6.695e-10
Identity = 43/131 (32.82%), Postives = 68/131 (51.91%), Query Frame = 1
Query:   61 DSMIPSKVDTVASSGVITDNSYVKSLSVSQADLRKXXXXXXXXXXXXXXGFSHVSPRLD-MESTVSDSISGNPV--MDDYSWLDGYQLPASTKGSGPDGPIAYTQSNSHLVNHNIS-SGAVCFPFPGKQVP 441
            ++ IPS   ++ SS   + +  +KS SV    ++K              GF   + ++D   S ++     NP+  MDDYSWL+GYQLP++ +  G +    ++    H V+++ S  G V FPFPGKQVP
Sbjct:  673 EAAIPSTFSSLTSSVAGSGSMSMKSSSVISTGMKKNPVSRPVRHLGPPPGFGSAASKVDDSSSALTLRNENNPISRMDDYSWLNGYQLPSTHQSIGYNNSHNHSTQTYHSVSNSGSLVGVVSFPFPGKQVP 803          
BLAST of CD860474 vs. TrEMBL
Match: B9H8U5_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_560381 PE=4 SV=1)

HSP 1 Score: 59.6918 bits (143), Expect = 1.396e-7
Identity = 46/143 (32.17%), Postives = 65/143 (45.45%), Query Frame = 1
Query:   52 KTEDSMIPSKVDTVASSGVITDNSYVKSLSVSQADLRKXXXXXXXXXXXXXXGFSHVSPRLDMESTVSDSISGNPV-MDDYSWLDGYQLPASTKGSGPDGPIAYTQSNSHLVNHNIS-SGAVCFPFPGKQVPSALQGVK-QNG 471
            K  D+++  K + V SS    D+  +K+ SV  A  R               GFS V P+   E             MDDYSWLDGYQ P+S K +  +  I + + + H    N   +G   FPFPGKQ+ +    ++ QNG
Sbjct:  787 KVPDTVVHLKSEPVMSSVSGFDSLSLKASSVFPASSRLNPVSRPVHHLGPPPGFSSVPPKAKCEILSGIGQENYDFHMDDYSWLDGYQPPSSAKATVFNNSINHPEQSCHHTTANDGLTGTRMFPFPGKQLQTFPMKIESQNG 929          
BLAST of CD860474 vs. Lotus protein
Match: chr6.CM0584.350.r2.d (- phase: 0 /pseudo/partial)

HSP 1 Score: 149.828 bits (377), Expect = 4.042e-37
Identity = 78/158 (49.37%), Postives = 105/158 (66.46%), Query Frame = 1
Query:   19 GTGTKSFYGLPKTEDSMIPSKVDTVASSGVITDNSYVKSLSVSQADLRKXXXXXXXXXXXXXX--GFSHVSPRLDMESTVSDSISGNPVMDDYSWLDGYQLPASTKGSGPDGPIAYTQSNSHLVNHNISSGAVCFPFPGKQVPSA-LQGVKQNGWQDY 483
            G  T  F+GL K  +S++PSK+D +ASSGV++D   VK+ S  Q  +RK                GF+HV  +  +E T SDS+SGNP++DDYSWLDGYQL +STKG   +G +AY+QSNS+ +++N  +G + FPFPGKQVPS  LQ  +QN WQDY
Sbjct:  804 GVDTNVFHGLSKASESVVPSKIDAIASSGVVSDAFAVKT-SAMQPGMRKAPAPVSRPARHLGPPPGFNHVPSKQSIEFTTSDSMSGNPILDDYSWLDGYQLQSSTKGLSSNGSLAYSQSNSYQLSNNGLNGNISFPFPGKQVPSVPLQVEQQNVWQDY 960          
BLAST of CD860474 vs. Lotus protein
Match: chr2.CM0308.590.r2.d (+ phase: 0 /pseudo)

HSP 1 Score: 76.2554 bits (186), Expect = 5.680e-15
Identity = 43/77 (55.84%), Postives = 47/77 (61.04%), Query Frame = 2
Query:  257 IQLVGILLW-MTTVGWMDISCLHQPKVQAPMVXXXXXXXXXXXXXXXFRVGQFAFLFLENKFHLHCRGSNRMVGKII 484
            ++L GIL   M TVGWMDI  LHQPK+ AP+V                 VGQ AF  LENKFHLHCRG N MVGKII
Sbjct:  286 VRLNGILFTRMITVGWMDIIILHQPKI*APIVLLLTLSQILNKSVTMD*VGQSAFPSLENKFHLHCRGENSMVGKII 362          
BLAST of CD860474 vs. Soybean peptides
Match: Glyma14g03940.1|PACid:16294277 ()

HSP 1 Score: 167.933 bits (424), Expect = 3.575e-42
Identity = 82/138 (59.42%), Postives = 96/138 (69.57%), Query Frame = 1
Query:   70 IPSKVDTVASSGVITDNSYVKSLSVSQADLRKXXXXXXXXXXXXXXGFSHVSPRLDMESTVSDSISGNPVMDDYSWLDGYQLPASTKGSGPDGPIAYTQSNSHLVNHNISSGAVCFPFPGKQVPSALQGVKQNGWQDY 483
            I SK++ +ASSG  T+NS VK+ S  QA L+K              GFSHV P+   E TVSD ISGNP+MDDYSWLDGYQLPAST G GP+GP+ Y+QSNS  V +N  SG V FPFPGKQ+PS LQ  KQNGWQD+
Sbjct:  569 ISSKIEAIASSGTFTENSVVKTSSTLQAGLKKSPVNRPSRHLGPPPGFSHVPPKQCSEPTVSDLISGNPIMDDYSWLDGYQLPASTNGLGPNGPLTYSQSNSRQVGNNGLSGTVSFPFPGKQIPSTLQVEKQNGWQDF 706          
BLAST of CD860474 vs. Soybean peptides
Match: Glyma02g44800.3|PACid:16250200 ()

HSP 1 Score: 166.007 bits (419), Expect = 1.359e-41
Identity = 87/154 (56.49%), Postives = 99/154 (64.29%), Query Frame = 1
Query:   28 TKSFYG--LPKTEDSMIPSKVDTVASSGVITDNSYVKSLSVSQADLRKXXXXXXXXXXXXXXGFSHVSPRLDMESTVSDSISGNPVMDDYSWLDGYQLPASTKGSGPDGPIAYTQSNSHLVNHNISSGAVCFPFPGKQVPSALQGVKQNGWQDY 483
            T  FY   L K ED  I SK+D +ASSG  TDNS VK+ S  QA L+K              GFSHV P+     TVSDSISGNP+MDDYSWLDGYQLPAST   GPDGP+ Y+QSN H +     SG   FPFPGKQ+PS LQ  KQNGW+D+
Sbjct:  775 TNMFYAHDLSKAEDFAISSKIDAIASSGTFTDNSVVKTSSTLQAGLKKSLVSRPSRHLGPPPGFSHVPPKQG-SPTVSDSISGNPIMDDYSWLDGYQLPASTNDLGPDGPLTYSQSNPHQIG---LSGTASFPFPGKQIPSTLQVEKQNGWRDF 924          
BLAST of CD860474 vs. Soybean peptides
Match: Glyma02g44800.2|PACid:16250199 ()

HSP 1 Score: 166.007 bits (419), Expect = 1.359e-41
Identity = 87/154 (56.49%), Postives = 99/154 (64.29%), Query Frame = 1
Query:   28 TKSFYG--LPKTEDSMIPSKVDTVASSGVITDNSYVKSLSVSQADLRKXXXXXXXXXXXXXXGFSHVSPRLDMESTVSDSISGNPVMDDYSWLDGYQLPASTKGSGPDGPIAYTQSNSHLVNHNISSGAVCFPFPGKQVPSALQGVKQNGWQDY 483
            T  FY   L K ED  I SK+D +ASSG  TDNS VK+ S  QA L+K              GFSHV P+     TVSDSISGNP+MDDYSWLDGYQLPAST   GPDGP+ Y+QSN H +     SG   FPFPGKQ+PS LQ  KQNGW+D+
Sbjct:  775 TNMFYAHDLSKAEDFAISSKIDAIASSGTFTDNSVVKTSSTLQAGLKKSLVSRPSRHLGPPPGFSHVPPKQG-SPTVSDSISGNPIMDDYSWLDGYQLPASTNDLGPDGPLTYSQSNPHQIG---LSGTASFPFPGKQIPSTLQVEKQNGWRDF 924          
BLAST of CD860474 vs. Soybean peptides
Match: Glyma02g44800.1|PACid:16250198 ()

HSP 1 Score: 166.007 bits (419), Expect = 1.359e-41
Identity = 87/154 (56.49%), Postives = 99/154 (64.29%), Query Frame = 1
Query:   28 TKSFYG--LPKTEDSMIPSKVDTVASSGVITDNSYVKSLSVSQADLRKXXXXXXXXXXXXXXGFSHVSPRLDMESTVSDSISGNPVMDDYSWLDGYQLPASTKGSGPDGPIAYTQSNSHLVNHNISSGAVCFPFPGKQVPSALQGVKQNGWQDY 483
            T  FY   L K ED  I SK+D +ASSG  TDNS VK+ S  QA L+K              GFSHV P+     TVSDSISGNP+MDDYSWLDGYQLPAST   GPDGP+ Y+QSN H +     SG   FPFPGKQ+PS LQ  KQNGW+D+
Sbjct:  775 TNMFYAHDLSKAEDFAISSKIDAIASSGTFTDNSVVKTSSTLQAGLKKSLVSRPSRHLGPPPGFSHVPPKQG-SPTVSDSISGNPIMDDYSWLDGYQLPASTNDLGPDGPLTYSQSNPHQIG---LSGTASFPFPGKQIPSTLQVEKQNGWRDF 924          
BLAST of CD860474 vs. Soybean peptides
Match: Glyma20g08040.2|PACid:16315686 ()

HSP 1 Score: 165.236 bits (417), Expect = 2.317e-41
Identity = 87/150 (58.00%), Postives = 101/150 (67.33%), Query Frame = 1
Query:   37 FYGLPKTEDSMIPSKVDTVASSGVITDNSYVKSLSVSQADLRKXXXXXXXXXXXXXXGFSHVSPRLDMESTVSDSISGNPVMDDYSWLDGYQLPASTKGSGPDGPIAYTQSNSHLVNHNISSGAVCFPFPGKQVPSA-LQGVKQNGWQDY 483
            FYG  K  +S +PSKVDT+ASSGV+TDN  VK+ S      RK              GFSHV P+  +ESTVSDSISGNP+MDDYSWLDGY L +STKG G +GP+ Y+QSNS  V++N  S    FPFPGKQVP   LQ  KQNGWQDY
Sbjct:  767 FYGFSKALESAVPSKVDTIASSGVVTDNLAVKT-SALPVGSRKAPVSRPTRHLGPPPGFSHVPPKQGIESTVSDSISGNPIMDDYSWLDGYHLHSSTKGLGSNGPLNYSQSNSQQVSNNGLSPTASFPFPGKQVPPVPLQVEKQNGWQDY 915          
BLAST of CD860474 vs. Soybean peptides
Match: Glyma20g08040.1|PACid:16315685 ()

HSP 1 Score: 165.236 bits (417), Expect = 2.317e-41
Identity = 87/150 (58.00%), Postives = 101/150 (67.33%), Query Frame = 1
Query:   37 FYGLPKTEDSMIPSKVDTVASSGVITDNSYVKSLSVSQADLRKXXXXXXXXXXXXXXGFSHVSPRLDMESTVSDSISGNPVMDDYSWLDGYQLPASTKGSGPDGPIAYTQSNSHLVNHNISSGAVCFPFPGKQVPSA-LQGVKQNGWQDY 483
            FYG  K  +S +PSKVDT+ASSGV+TDN  VK+ S      RK              GFSHV P+  +ESTVSDSISGNP+MDDYSWLDGY L +STKG G +GP+ Y+QSNS  V++N  S    FPFPGKQVP   LQ  KQNGWQDY
Sbjct:  770 FYGFSKALESAVPSKVDTIASSGVVTDNLAVKT-SALPVGSRKAPVSRPTRHLGPPPGFSHVPPKQGIESTVSDSISGNPIMDDYSWLDGYHLHSSTKGLGSNGPLNYSQSNSQQVSNNGLSPTASFPFPGKQVPPVPLQVEKQNGWQDY 918          
BLAST of CD860474 vs. Soybean peptides
Match: Glyma07g35910.1|PACid:16268866 ()

HSP 1 Score: 162.54 bits (410), Expect = 1.502e-40
Identity = 84/150 (56.00%), Postives = 103/150 (68.67%), Query Frame = 1
Query:   37 FYGLPKTEDSMIPSKVDTVASSGVITDNSYVKSLSVSQADLRKXXXXXXXXXXXXXXGFSHVSPRLDMESTVSDSISGNPVMDDYSWLDGYQLPASTKGSGPDGPIAYTQSNSHLVNHNISSGAVCFPFPGKQVPSA-LQGVKQNGWQDY 483
            FYG  K  +S++PSKVD +ASSGV+TDN  V + ++     RK              GFSHV P+  +ESTVSD+ISGNP+MDDYSWLDGY L ASTKG G +GP+ Y+QSN+  V++N  +  V FPFPGKQVPS  LQ  KQNGWQDY
Sbjct:  732 FYGFSKALESVVPSKVDVIASSGVVTDNLAVNTPTLPVGS-RKAPVSRPTRHLGPPPGFSHVPPKQGIESTVSDAISGNPIMDDYSWLDGYHLHASTKGLGSNGPLNYSQSNAQQVSNNGLNPTVSFPFPGKQVPSVPLQVEKQNGWQDY 880          
BLAST of CD860474 vs. Medicago proteins
Match: IMGA|Medtr5g089510.1 (Telomerase-binding protein EST1A (AHRD V1 *--- Q86US8); contains Interpro domain(s) IPR019458 Telomerase activating protein Est1 chr05_pseudomolecule_IMGAG_V3.5 37863946-37871859 E EGN_Mt100125 20100825)

HSP 1 Score: 212.616 bits (540), Expect = 7.493e-56
Identity = 105/151 (69.54%), Postives = 115/151 (76.16%), Query Frame = 1
Query:   22 TGTKSFYGLPKTEDSMIPSKVDTVASSGVITDNSYVKSLSVSQADLRKXXXXXXXXXXXXXXGFSHVSPRLDMESTVSDSISGNPVMDDYSWLDGYQLPASTKGSGPDGPIAYTQSNSHLVNHNISSGAVCFPFPGKQVPSALQGVKQNGW 474
            TG  SFYGL K ED  IP KVDTVASSGVITDNSYVKS SV QA L+K              GFSHVSP+LDMESTVSDSISGNPVMDDYSWLDGYQLP+STK   PDGP+ YTQ+N+  +N+NI SG  CFPFPGK +PSA+QG  QNGW
Sbjct:  770 TGANSFYGLSKAEDFTIPFKVDTVASSGVITDNSYVKSSSVLQAGLKKSPVSRPSRHLGPPPGFSHVSPKLDMESTVSDSISGNPVMDDYSWLDGYQLPSSTKALCPDGPMTYTQTNTQQINNNILSGPACFPFPGKLLPSAMQGGMQNGW 920          
The following BLAST results are available for this feature:
BLAST of CD860474 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Trembl)
Total hits: 7
Match NameE-valueIdentityDescription
B9SJ73_RICCO8.508e-2445.10Smg-7, putative OS=Ricinus communis GN=RCOM_147820... [more]
B9GG80_POPTR2.562e-2041.51Predicted protein (Fragment) OS=Populus trichocarp... [more]
D7TIP2_VITVI4.679e-1439.26Whole genome shotgun sequence of line PN40024, sca... [more]
D7LZ76_ARALY7.982e-1435.92Putative uncharacterized protein OS=Arabidopsis ly... [more]
Q3E7L8_ARATH4.380e-1236.62Putative uncharacterized protein At5g19400.1 OS=Ar... [more]
Q8W417_TOBAC5.354e-1032.82Cig3 OS=Nicotiana tabacum GN=cig3 PE=2 SV=1[more]
B9H8U5_POPTR1.116e-732.17Predicted protein OS=Populus trichocarpa GN=POPTRD... [more]
back to top
BLAST of CD860474 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Pisum sativum unigene v1 vs TAIR 10 peptide)
Total hits: 3
Match NameE-valueIdentityDescription
AT5G19400.23.627e-1436.62| Symbols: SMG7 | Telomerase activating protein Es... [more]
AT5G19400.33.627e-1436.62| Symbols: SMG7 | Telomerase activating protein Es... [more]
AT5G19400.13.627e-1436.62| Symbols: SMG7 | Telomerase activating protein Es... [more]
back to top
BLAST of CD860474 vs. TAIR peptide
Analysis Date: 2011-04-21 (Homology Analysis: Pisum sativum unigene v2 vs TAIR 10 peptide)
Total hits: 3
Match NameE-valueIdentityDescription
AT5G19400.23.627e-1436.62| Symbols: SMG7 | Telomerase activating protein Es... [more]
AT5G19400.33.627e-1436.62| Symbols: SMG7 | Telomerase activating protein Es... [more]
AT5G19400.13.627e-1436.62| Symbols: SMG7 | Telomerase activating protein Es... [more]
back to top
BLAST of CD860474 vs. TrEMBL
Analysis Date: 2011-04-27 (Homology Analysis: Pisum sativum unigene v2 vs Trembl)
Total hits: 7
Match NameE-valueIdentityDescription
B9SJ73_RICCO1.064e-2345.10Smg-7, putative OS=Ricinus communis GN=RCOM_147820... [more]
B9GG80_POPTR3.203e-2041.51Predicted protein (Fragment) OS=Populus trichocarp... [more]
D7TIP2_VITVI5.851e-1439.26Whole genome shotgun sequence of line PN40024, sca... [more]
D7LZ76_ARALY9.981e-1435.92Putative uncharacterized protein OS=Arabidopsis ly... [more]
Q3E7L8_ARATH5.477e-1236.62SMG7-like protein OS=Arabidopsis thaliana GN=SMG7 ... [more]
Q8W417_TOBAC6.695e-1032.82Cig3 OS=Nicotiana tabacum GN=cig3 PE=2 SV=1[more]
B9H8U5_POPTR1.396e-732.17Predicted protein OS=Populus trichocarpa GN=POPTRD... [more]
back to top
BLAST of CD860474 vs. Lotus protein
Analysis Date: 2011-04-21 (Homology Analysis: Pisum sativum unigene v2 vs Lotus proteins)
Total hits: 2
Match NameE-valueIdentityDescription
chr6.CM0584.350.r2.d4.042e-3749.37- phase: 0 /pseudo/partial[more]
chr2.CM0308.590.r2.d5.680e-1555.84+ phase: 0 /pseudo[more]
back to top
BLAST of CD860474 vs. Soybean peptides
Analysis Date: 2011-04-21 (Homology Analysis: Pisum sativum unigene v2 vs Soybean peptides)
Total hits: 7
Match NameE-valueIdentityDescription
Glyma14g03940.1|PACid:162942773.575e-4259.42[more]
Glyma02g44800.3|PACid:162502001.359e-4156.49[more]
Glyma02g44800.2|PACid:162501991.359e-4156.49[more]
Glyma02g44800.1|PACid:162501981.359e-4156.49[more]
Glyma20g08040.2|PACid:163156862.317e-4158.00[more]
Glyma20g08040.1|PACid:163156852.317e-4158.00[more]
Glyma07g35910.1|PACid:162688661.502e-4056.00[more]
back to top
BLAST of CD860474 vs. Medicago proteins
Analysis Date: 2011-04-21 (Homology Analysis: Pisum sativum unigene v2 vs Medicago proteins)
Total hits: 1
Match NameE-valueIdentityDescription
IMGA|Medtr5g089510.17.493e-5669.54Telomerase-binding protein EST1A (AHRD V1 *--- Q86... [more]
back to top
InterPro
Analysis Name: InterProScan analysis for Pisum sativum unigene v2
Date Performed: 2011-04-27
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableSEGsegsegcoord: 3..25
score
NoneNo IPR availableSEGsegsegcoord: 56..69
score

Analysis Name: InterProScan analysis for Pisum sativum unigene v1
Date Performed: 2010-12-29
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableSEGsegsegcoord: 56..69
score
NoneNo IPR availableSEGsegsegcoord: 3..25
score

Properties
Property NameValue
Singlet in analysisPisum sativum unigene v2
Singlet in analysisPisum sativum unigene v1
Sequences
The following sequences are available for this feature:

EST sequence

>CD860474 ID=CD860474|Name=CD860474|organism=Pisum sativum|type=EST|length=485bp
TCGAGCGGCGCCCGGGCAGGTACTGGGACTAAATCATTTTATGGTCTCCC
AAAAACTGAAGACTCGATGATACCATCCAAAGTTGATACTGTTGCATCTT
CTGGAGTCATTACGGATAACTCTTATGTGAAGTCATTGTCAGTTTCGCAA
GCTGATTTGAGAAAATCTCCAGTTAGCCGTCCTTCTAGGCACCGTGGACC
TCCTCCTGGTTTCAGTCATGTTTCTCCTAGGCTTGATATGGAATCCACTG
TTTCAGATTCAATTAGTGGGAATCCTGTTATGGATGACTACAGTTGGTTG
GATGGATATCAGTTGCCTGCATCAACCAAAGGTTCAGGCCCCGATGGTCC
TATTGCTTATACTCAATCAAATTCCCATCTAGTAAATCACAATATTTCGA
GTGGGGCAGTTTGCTTTCCTTTTCCTGGAAAACAAGTTCCATCTGCACTG
CAGGGGGTCAAACAGAATGGTTGGCAAGATTATCA
back to top