FG537132
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of FG537132 vs. Soybean peptides
Match: Glyma02g41900.1|PACid:16249847 () HSP 1 Score: 56.9954 bits (136), Expect = 5.846e-9 Identity = 27/52 (51.92%), Postives = 34/52 (65.38%), Query Frame = 2 Query: 2 RHLPRPVYKAAALMRTMXXXXXXXXXXXXXXXXPGSVTTKPLRVKRIVKEVE 157 RHLPRP++KA+ALMR M PGS+TT+PLR +RI+KEVE Sbjct: 401 RHLPRPIFKASALMRVMADAKRRKEEKRKAHSAPGSITTQPLRRRRIIKEVE 452
BLAST of FG537132 vs. Soybean peptides
Match: Glyma14g07070.1|PACid:16294663 () HSP 1 Score: 53.9138 bits (128), Expect = 4.949e-8 Identity = 26/52 (50.00%), Postives = 33/52 (63.46%), Query Frame = 2 Query: 2 RHLPRPVYKAAALMRTMXXXXXXXXXXXXXXXXPGSVTTKPLRVKRIVKEVE 157 RHLPRP++KA+ALM M PGS+TT+PLR +RI+KEVE Sbjct: 402 RHLPRPIFKASALMCVMADAKRRKEEKRKAHSAPGSITTQPLRRRRIIKEVE 453
BLAST of FG537132 vs. Medicago proteins
Match: IMGA|Medtr1g022960.3 (DDB1- and CUL4-associated factor 13 (AHRD V1 ***- Q803X4); contains Interpro domain(s) IPR017986 WD40 repeat, region chr01_pseudomolecule_IMGAG_V3.5 6982466-6979647 E EGN_Mt100125 20100825) HSP 1 Score: 55.8398 bits (133), Expect = 7.779e-9 Identity = 26/52 (50.00%), Postives = 34/52 (65.38%), Query Frame = 2 Query: 2 RHLPRPVYKAAALMRTMXXXXXXXXXXXXXXXXPGSVTTKPLRVKRIVKEVE 157 RHLPRP+YKA++L+R + PGSVTTKPLR +RI++EVE Sbjct: 218 RHLPRPIYKASSLLRVIADAKKKKEERRKAHSAPGSVTTKPLRKRRIIREVE 269
BLAST of FG537132 vs. Medicago proteins
Match: IMGA|Medtr1g022960.2 (DDB1- and CUL4-associated factor 13 (AHRD V1 ***- Q5ZLK1); contains Interpro domain(s) IPR020472 G-protein beta WD-40 repeat, region chr01_pseudomolecule_IMGAG_V3.5 6985587-6979647 E EGN_Mt100125 20100825) HSP 1 Score: 55.8398 bits (133), Expect = 7.779e-9 Identity = 26/52 (50.00%), Postives = 34/52 (65.38%), Query Frame = 2 Query: 2 RHLPRPVYKAAALMRTMXXXXXXXXXXXXXXXXPGSVTTKPLRVKRIVKEVE 157 RHLPRP+YKA++L+R + PGSVTTKPLR +RI++EVE Sbjct: 401 RHLPRPIYKASSLLRVIADAKKKKEERRKAHSAPGSVTTKPLRKRRIIREVE 452
BLAST of FG537132 vs. Medicago proteins
Match: IMGA|Medtr1g022960.1 (DDB1- and CUL4-associated factor 13 (AHRD V1 ***- Q5ZLK1); contains Interpro domain(s) IPR020472 G-protein beta WD-40 repeat, region chr01_pseudomolecule_IMGAG_V3.5 6985587-6979647 E EGN_Mt100125 20100825) HSP 1 Score: 55.8398 bits (133), Expect = 7.779e-9 Identity = 26/52 (50.00%), Postives = 34/52 (65.38%), Query Frame = 2 Query: 2 RHLPRPVYKAAALMRTMXXXXXXXXXXXXXXXXPGSVTTKPLRVKRIVKEVE 157 RHLPRP+YKA++L+R + PGSVTTKPLR +RI++EVE Sbjct: 405 RHLPRPIYKASSLLRVIADAKKKKEERRKAHSAPGSVTTKPLRKRRIIREVE 456
BLAST of FG537132 vs. Medicago proteins
Match: IMGA|AC235668_10.1 (DDB1- and CUL4-associated factor 13 (AHRD V1 ***- Q5ZLK1); contains Interpro domain(s) IPR020472 G-protein beta WD-40 repeat, region AC235668.7 42664-36635 E EGN_Mt100125 20100825) HSP 1 Score: 55.8398 bits (133), Expect = 7.779e-9 Identity = 26/52 (50.00%), Postives = 34/52 (65.38%), Query Frame = 2 Query: 2 RHLPRPVYKAAALMRTMXXXXXXXXXXXXXXXXPGSVTTKPLRVKRIVKEVE 157 RHLPRP+YKA++L+R + PGSVTTKPLR +RI++EVE Sbjct: 401 RHLPRPIYKASSLLRVIADAKKKKEERRKAHSAPGSVTTKPLRKRRIIREVE 452 The following BLAST results are available for this feature:
BLAST of FG537132 vs. Soybean peptides
Analysis Date: 2011-04-21 (Homology Analysis: Pisum sativum unigene v2 vs Soybean peptides) Total hits: 2
BLAST of FG537132 vs. Medicago proteins
Analysis Date: 2011-04-21 (Homology Analysis: Pisum sativum unigene v2 vs Medicago proteins) Total hits: 4
InterPro
Analysis Name: InterProScan analysis for Pisum sativum unigene v2
Date Performed: 2011-04-27
Analysis Name: InterProScan analysis for Pisum sativum unigene v1 Date Performed: 2010-12-29
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >FG537132 ID=FG537132; Name=FG537132; organism=Pisum sativum; type=EST; length=408bpback to top Annotated Terms
The
following terms have been associated with
this EST:
|