CD859707

EST Overview
NameCD859707
Unique NameCD859707
TypeEST
OrganismPisum sativum (pea)
Sequence length688
Libraries
Library NameType
LIBEST_014001 G15cdna_library
Unigenes
This EST is part of the following unigenes:
Unigene NameAnalysis NameSequence type in Unigene
Pisum sativum unigene v1Pisum sativum unigene v1EST
Homology
BLAST of CD859707 vs. TrEMBL
Match: C6TKH0_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1)

HSP 1 Score: 328.561 bits (841), Expect = 2.923e-88
Identity = 165/209 (78.95%), Postives = 184/209 (88.04%), Query Frame = 3
Query:   63 MRSN-EPMLPPQSQKAQPGKEYLMEPLPQSINPNHKPSNKLRGKVALVTGGDSGIGRAVSLIFAKEGATVAFTYVKGHEEIDKDETLKMLLEAKTSDSQEPLAIAADIGYDDNCKQVIELVVKEYGHIDILVNNAAEQHLKDSVEEITEEQLERVFRTNIFSNFFLVRHALKHMKEGSSIINSTSVNAYTGQAETLDYTSTKGAIVAFT 686
            M SN E   P QSQK QPGKE++M PLPQ+ NP+HK +NKL+GKVALVTGGDSGIGRAV L FAKEGATVAFTYVKGHE+ DKD+TLKMLLEAKTS +  PLAIAADIG+D+NCKQVI+LVVKEYG +D+LVNNAAEQHL +SVEEIT++QLERVF TNIFS FFLV+HALKHMKEGS IINSTSVNAY G  E LDYT+TKGAIVAFT
Sbjct:    1 MASNKESKFPAQSQKTQPGKEHVMNPLPQATNPDHKAANKLQGKVALVTGGDSGIGRAVCLCFAKEGATVAFTYVKGHEDRDKDDTLKMLLEAKTSGADNPLAIAADIGFDENCKQVIDLVVKEYGRLDVLVNNAAEQHLTNSVEEITQQQLERVFGTNIFSQFFLVKHALKHMKEGSCIINSTSVNAYNGNPEALDYTATKGAIVAFT 209          
BLAST of CD859707 vs. TrEMBL
Match: Q9LLQ6_SOYBN (Seed maturation protein PM34 OS=Glycine max GN=PM34 PE=2 SV=1)

HSP 1 Score: 293.123 bits (749), Expect = 1.361e-77
Identity = 144/208 (69.23%), Postives = 175/208 (84.13%), Query Frame = 3
Query:   63 MRSNEPMLPPQSQKAQPGKEYLMEPLPQSINPNHKPSNKLRGKVALVTGGDSGIGRAVSLIFAKEGATVAFTYVKGHEEIDKDETLKMLLEAKTSDSQEPLAIAADIGYDDNCKQVIELVVKEYGHIDILVNNAAEQHLKDSVEEITEEQLERVFRTNIFSNFFLVRHALKHMKEGSSIINSTSVNAYTGQAETLDYTSTKGAIVAFT 686
            M S E   PPQ Q+ QPGKE+ M P+PQ  +P++KPSNKL+GK+ALVTGGDSGIGRAV  +FA EGATVAFTYVKGHE+ D  +TL+M+  AKTSD+++P+AIA+D+GYD+NCK+V++ VV  YG IDILVNNAAEQ+   +VE+I E +LERVFRTNIFS FF+ RHALKHMKEGSSIIN+TSVNAY G A+ LDYTSTKGAIVA+T
Sbjct:    1 MASGEQKFPPQQQQTQPGKEHAMTPVPQFTSPDYKPSNKLQGKIALVTGGDSGIGRAVCNLFALEGATVAFTYVKGHEDKDARDTLEMIKRAKTSDAKDPMAIASDLGYDENCKRVVDEVVSAYGCIDILVNNAAEQYECGTVEDIDEPRLERVFRTNIFSYFFMARHALKHMKEGSSIINTTSVNAYKGHAKLLDYTSTKGAIVAYT 208          
BLAST of CD859707 vs. TrEMBL
Match: C6TAX1_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1)

HSP 1 Score: 290.426 bits (742), Expect = 8.822e-77
Identity = 143/208 (68.75%), Postives = 174/208 (83.65%), Query Frame = 3
Query:   63 MRSNEPMLPPQSQKAQPGKEYLMEPLPQSINPNHKPSNKLRGKVALVTGGDSGIGRAVSLIFAKEGATVAFTYVKGHEEIDKDETLKMLLEAKTSDSQEPLAIAADIGYDDNCKQVIELVVKEYGHIDILVNNAAEQHLKDSVEEITEEQLERVFRTNIFSNFFLVRHALKHMKEGSSIINSTSVNAYTGQAETLDYTSTKGAIVAFT 686
            M S E   PPQ Q+ QPGKE+ M P+PQ  +P++KPSNKL+GK+ALVTGGDSGIGRAV  +FA EGATVAFTYVKGHE+ D  +TL+M+  AKTSD+++P+AIA+D+GYD+NCK+V++ VV  YG IDILVNNAAEQ+   +V +I E +LERVFRTNIFS FF+ RHALKHMKEGSSIIN+TSVNAY G A+ LDYTSTKGAIVA+T
Sbjct:    1 MASGEQKFPPQQQQTQPGKEHAMTPVPQFTSPDYKPSNKLQGKIALVTGGDSGIGRAVCNLFALEGATVAFTYVKGHEDKDARDTLEMIKRAKTSDAKDPMAIASDLGYDENCKRVVDEVVSAYGCIDILVNNAAEQYECGTVGDIDEPRLERVFRTNIFSYFFMARHALKHMKEGSSIINTTSVNAYKGHAKLLDYTSTKGAIVAYT 208          
BLAST of CD859707 vs. TrEMBL
Match: C6T8W9_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1)

HSP 1 Score: 288.115 bits (736), Expect = 4.378e-76
Identity = 141/208 (67.79%), Postives = 172/208 (82.69%), Query Frame = 3
Query:   63 MRSNEPMLPPQSQKAQPGKEYLMEPLPQSINPNHKPSNKLRGKVALVTGGDSGIGRAVSLIFAKEGATVAFTYVKGHEEIDKDETLKMLLEAKTSDSQEPLAIAADIGYDDNCKQVIELVVKEYGHIDILVNNAAEQHLKDSVEEITEEQLERVFRTNIFSNFFLVRHALKHMKEGSSIINSTSVNAYTGQAETLDYTSTKGAIVAFT 686
            M S     PPQ Q+ QPGKE+ M P+PQ  +P++KPSNKL+GK+ALVTGGDSGIGRAV  +FA EGATV FTYVKGHE+ D  +TL+M+  AKTSD+++P+A+ AD+GYD+NCK+V++ VV  YG IDILVNNAAEQ+   +VE+I E +LERVFRTNIFS FF+ RHALKHMKEGSSIIN+TSVNAY G A+ LDYTSTKGAIVA+T
Sbjct:    1 MASGGKKFPPQQQQTQPGKEHAMNPVPQFASPDYKPSNKLQGKIALVTGGDSGIGRAVCNLFALEGATVGFTYVKGHEDKDARDTLEMIKRAKTSDAKDPMAVPADLGYDENCKRVVDEVVNAYGCIDILVNNAAEQYECGTVEDIDEPRLERVFRTNIFSYFFMTRHALKHMKEGSSIINTTSVNAYKGNAKLLDYTSTKGAIVAYT 208          
BLAST of CD859707 vs. TrEMBL
Match: B9RTX3_RICCO (Short chain dehydrogenase, putative OS=Ricinus communis GN=RCOM_0913600 PE=3 SV=1)

HSP 1 Score: 285.034 bits (728), Expect = 3.706e-75
Identity = 141/200 (70.50%), Postives = 164/200 (82.00%), Query Frame = 3
Query:   87 PPQSQKAQPGKEYLMEPLPQSINPNHKPSNKLRGKVALVTGGDSGIGRAVSLIFAKEGATVAFTYVKGHEEIDKDETLKMLLEAKTSDSQEPLAIAADIGYDDNCKQVIELVVKEYGHIDILVNNAAEQHLKDSVEEITEEQLERVFRTNIFSNFFLVRHALKHMKEGSSIINSTSVNAYTGQAETLDYTSTKGAIVAFT 686
            PPQ+Q  QPGK+Y+M PLPQSINP++KPSNKL GKVALVTGGDSGIGRAV   F+ EGATVAFTYVKG E+ DKD+ L+M  E K  D+++P+AIA DI Y++NCK+VI+ VV EYG ID+LVNNA  QH   S+EEITE  LE +FRTNIFS FFLVRHALKHMKEGSSIIN+TSV AYTG    LDY STKGAI++FT
Sbjct:   11 PPQTQDQQPGKQYVMHPLPQSINPDYKPSNKLHGKVALVTGGDSGIGRAVCYYFSLEGATVAFTYVKGIEDKDKDDALEMFQEVKAKDAKDPIAIATDIRYEENCKKVIDEVVNEYGRIDVLVNNAGLQHYTYSIEEITEVDLESLFRTNIFSQFFLVRHALKHMKEGSSIINTTSVLAYTGHPNLLDYCSTKGAILSFT 210          
BLAST of CD859707 vs. TrEMBL
Match: B9I7W9_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_729630 PE=3 SV=1)

HSP 1 Score: 283.493 bits (724), Expect = 1.078e-74
Identity = 139/207 (67.15%), Postives = 170/207 (82.13%), Query Frame = 3
Query:   63 MRSNEPMLPPQSQKAQPGKEYLMEPLPQSINPNHKPSNKLRGKVALVTGGDSGIGRAVSLIFAKEGATVAFTYVKGHEEIDKDETLKMLLEAKTSDSQEPLAIAADIGYDDNCKQVIELVVKEYGHIDILVNNAAEQHLKDSVEEITEEQLERVFRTNIFSNFFLVRHALKHMKEGSSIINSTSVNAYTGQAETLDYTSTKGAIVAF 683
            M S     PPQ Q +QPGKE++M+P PQ  NP++KPSNKL+GKVA+VTGGDSGIGRAV   F  EGATVAFTYVK  E+ D D+TL+ML + KT+D+++P+AI  D+G+D+NCK+V++ VV  YG IDILVNNAAEQ+   SVEEI E++LE+VFRTNIFS FF+ RHALKHMKEGSSIIN+TSVNAY G ++ LDYTSTKGAIVAF
Sbjct:    1 MASGGQKFPPQKQNSQPGKEHVMDPTPQYTNPDYKPSNKLQGKVAVVTGGDSGIGRAVCRSFVIEGATVAFTYVKAQEDKDADDTLQMLKKHKTADAKDPIAIPVDLGFDENCKRVVDEVVNAYGRIDILVNNAAEQYECSSVEEIDEQRLEKVFRTNIFSYFFMTRHALKHMKEGSSIINTTSVNAYMGNSQLLDYTSTKGAIVAF 207          
BLAST of CD859707 vs. TrEMBL
Match: B9RF47_RICCO (Short chain dehydrogenase, putative OS=Ricinus communis GN=RCOM_1431360 PE=3 SV=1)

HSP 1 Score: 281.952 bits (720), Expect = 3.138e-74
Identity = 140/208 (67.31%), Postives = 170/208 (81.73%), Query Frame = 3
Query:   63 MRSNEPMLPPQSQKAQPGKEYLMEPLPQSINPNHKPSNKLRGKVALVTGGDSGIGRAVSLIFAKEGATVAFTYVKGHEEIDKDETLKMLLEAKTSDSQEPLAIAADIGYDDNCKQVIELVVKEYGHIDILVNNAAEQHLKDSVEEITEEQLERVFRTNIFSNFFLVRHALKHMKEGSSIINSTSVNAYTGQAETLDYTSTKGAIVAFT 686
            M S     PPQ Q +QPGKE+ M+P+PQ    ++KPS+KLRGKVALVTGGDSGIGRAV   F  EGATVAFTYVK  E+ D ++T+++L ++KT D++EP+AIAAD+GYD+NCK+VI+ VV  +G IDILVNNAAEQH   SV+EI EE+LERVFRTN+FS FF  RHALKHMKEGSSIIN+TS+NAY G A+ LDYT+TKGAIVAFT
Sbjct:    1 MASGGQSFPPQKQGSQPGKEHQMDPIPQYARSDYKPSDKLRGKVALVTGGDSGIGRAVCHSFVLEGATVAFTYVKKQEDRDAEDTIQLLKKSKTVDAKEPIAIAADLGYDENCKKVIDEVVNAFGRIDILVNNAAEQHKAGSVQEIDEERLERVFRTNMFSYFFATRHALKHMKEGSSIINTTSINAYKGNAKLLDYTATKGAIVAFT 208          
BLAST of CD859707 vs. TrEMBL
Match: Q8GSE7_LUPAN (Putative TAG factor protein OS=Lupinus angustifolius PE=2 SV=1)

HSP 1 Score: 280.796 bits (717), Expect = 6.990e-74
Identity = 143/209 (68.42%), Postives = 168/209 (80.38%), Query Frame = 3
Query:   63 MRSNEPMLPPQSQKAQPGKEYLMEPLPQSINPN-HKPSNKLRGKVALVTGGDSGIGRAVSLIFAKEGATVAFTYVKGHEEIDKDETLKMLLEAKTSDSQEPLAIAADIGYDDNCKQVIELVVKEYGHIDILVNNAAEQHLKDSVEEITEEQLERVFRTNIFSNFFLVRHALKHMKEGSSIINSTSVNAYTGQAETLDYTSTKGAIVAFT 686
            M S+E   PPQ Q  QPGKE+LM P PQ   P+ +KPS+KL+GK+A+VTGGDSGIGRAV  +FA EGATV FTYVKGHE+ D  +TL+++   KTSDS+EP AIA D+G+D+NCK+VI+ V+  YG IDILVNNAAEQ+   SVEEI E +LERVFRTNIFS FF+ RHALKHMKEGSSIIN+TSVNAY G    LDYTSTKGAIVAFT
Sbjct:    1 MASSEQKFPPQKQYTQPGKEHLMYPTPQFTCPDEYKPSDKLKGKIAVVTGGDSGIGRAVCNLFALEGATVIFTYVKGHEDKDAKDTLELIRRVKTSDSKEPKAIAVDLGFDENCKKVIDEVINAYGSIDILVNNAAEQYECGSVEEIDEPRLERVFRTNIFSYFFMTRHALKHMKEGSSIINTTSVNAYKGHPSLLDYTSTKGAIVAFT 209          
BLAST of CD859707 vs. TrEMBL
Match: A5BL99_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VITISV_015336 PE=3 SV=1)

HSP 1 Score: 279.641 bits (714), Expect = 1.557e-73
Identity = 137/199 (68.84%), Postives = 168/199 (84.42%), Query Frame = 3
Query:   87 PPQSQKAQPGKEYLMEPLPQSINPNHKPSNKLRGKVALVTGGDSGIGRAVSLIFAKEGATVAFTYVKGHEEIDKDETLKMLLEAKTSDSQEPLAIAADIGYDDNCKQVIELVVKEYGHIDILVNNAAEQHLKDSVEEITEEQLERVFRTNIFSNFFLVRHALKHMKEGSSIINSTSVNAYTGQAETLDYTSTKGAIVAF 683
            PPQ Q+ QPGKE++M P PQ INP+++P++KL+GKVALVTGGDSGIGRAV  ++A EGATVAFTYVK  E+ D  ETL+M+ +AK  D++EP+AIAAD+GYDDNC++V+E VV  YG IDILVNNAAEQ+   SVEEI EE+LERVFRTNIFS F L RHALK+M+EGSSIIN+TS+NAY G  + ++YTSTKGAIVAF
Sbjct:   10 PPQRQERQPGKEHVMTPTPQFINPDYRPAHKLQGKVALVTGGDSGIGRAVCYLYALEGATVAFTYVKAQEDRDAQETLQMIRKAKRDDAKEPIAIAADLGYDDNCRRVVEEVVAAYGRIDILVNNAAEQYKSCSVEEIDEERLERVFRTNIFSYFLLTRHALKYMQEGSSIINTTSINAYKGNNKLIEYTSTKGAIVAF 208          
BLAST of CD859707 vs. TrEMBL
Match: B9RTX2_RICCO (Short chain dehydrogenase, putative OS=Ricinus communis GN=RCOM_0913590 PE=3 SV=1)

HSP 1 Score: 279.256 bits (713), Expect = 2.034e-73
Identity = 137/200 (68.50%), Postives = 163/200 (81.50%), Query Frame = 3
Query:   87 PPQSQKAQPGKEYLMEPLPQSINPNHKPSNKLRGKVALVTGGDSGIGRAVSLIFAKEGATVAFTYVKGHEEIDKDETLKMLLEAKTSDSQEPLAIAADIGYDDNCKQVIELVVKEYGHIDILVNNAAEQHLKDSVEEITEEQLERVFRTNIFSNFFLVRHALKHMKEGSSIINSTSVNAYTGQAETLDYTSTKGAIVAFT 686
            PPQ+Q  QPGK+Y+M PLP SINP++KPSNKL GKVALVTGGDSGIGRAV   F+ EGATVAFTYVKG E+ DKD+ L+M+   K  D+++P+AIA DI Y++NCK+V++ VV  YG ID+LVNNAA +H   S+EEITE  LE +FRTNIFS FFLVRHALKHMKEGSSIIN+TSV AYTG    LDY STKGAI++FT
Sbjct:   11 PPQTQDQQPGKQYVMHPLPHSINPDYKPSNKLHGKVALVTGGDSGIGRAVCYYFSLEGATVAFTYVKGIEDKDKDDALEMVRRVKVKDAKDPIAIATDIRYEENCKKVVDEVVNGYGRIDVLVNNAALEHYTCSIEEITEADLESLFRTNIFSQFFLVRHALKHMKEGSSIINTTSVLAYTGDPNLLDYCSTKGAILSFT 210          
BLAST of CD859707 vs. SwissProt
Match: GRDH_DAUCA (Glucose and ribitol dehydrogenase OS=Daucus carota GN=CAISE5 PE=2 SV=1)

HSP 1 Score: 288.115 bits (736), Expect = 2.956e-77
Identity = 136/200 (68.00%), Postives = 176/200 (88.00%), Query Frame = 3
Query:   87 PPQSQKAQPGKEYLMEPLPQSINPNHKPSNKLRGKVALVTGGDSGIGRAVSLIFAKEGATVAFTYVKGHEEIDKDETLKMLLEAKTSDSQEPLAIAADIGYDDNCKQVIELVVKEYGHIDILVNNAAEQHLKDSVEEITEEQLERVFRTNIFSNFFLVRHALKHMKEGSSIINSTSVNAYTGQAETLDYTSTKGAIVAFT 686
            PPQ Q++QPGKE+LM+P PQ  +P++KP+NKL+GKVALVTGGDSGIGR+V   FA EGATVAFT+VKGHE+ D +ETL++L +AK+SD+++P+AIAAD+G+DDNCK+V++ VV  +G ID+LVNNAAEQ+   +VE+I EE+LERVFRTNIF+ FF+ RHALKHM+EGS+IIN+TS+NAY G A+ LDYT+TKGAIVAFT
Sbjct:    8 PPQKQESQPGKEHLMDPSPQHASPHYKPANKLQGKVALVTGGDSGIGRSVCYHFALEGATVAFTFVKGHEDKDANETLELLRKAKSSDAKDPIAIAADLGFDDNCKKVVDQVVNAFGSIDVLVNNAAEQYKASTVEDIDEERLERVFRTNIFAYFFMARHALKHMREGSTIINTTSINAYKGNAKLLDYTATKGAIVAFT 207          
BLAST of CD859707 vs. SwissProt
Match: GRDH1_ARATH (Glucose and ribitol dehydrogenase homolog 1 OS=Arabidopsis thaliana GN=At1g54870 PE=1 SV=1)

HSP 1 Score: 281.567 bits (719), Expect = 2.766e-75
Identity = 139/198 (70.20%), Postives = 164/198 (82.83%), Query Frame = 3
Query:   93 QSQKAQPGKEYLMEPLPQSINPNHKPSNKLRGKVALVTGGDSGIGRAVSLIFAKEGATVAFTYVKGHEEIDKDETLKMLLEAKTSDSQEPLAIAADIGYDDNCKQVIELVVKEYGHIDILVNNAAEQHLKDSVEEITEEQLERVFRTNIFSNFFLVRHALKHMKEGSSIINSTSVNAYTGQAETLDYTSTKGAIVAFT 686
            Q Q AQPGKE++ME  PQ  + +++PSNKLRGKVAL+TGGDSGIGRAV   FA EGATVAFTYVKG EE D  ETL+ML E KTSDS+EP+AI  D+G+D+NCK+V++ VV  +G ID+L+NNAAEQ+   ++EEI E +LERVFRTNIFS FFL RHALKHMKEGSSIIN+TSVNAY G A  LDYT+TKGAIVAFT
Sbjct:    6 QKQHAQPGKEHVMESSPQFSSSDYQPSNKLRGKVALITGGDSGIGRAVGYCFASEGATVAFTYVKGQEEKDAQETLQMLKEVKTSDSKEPIAIPTDLGFDENCKRVVDEVVNAFGRIDVLINNAAEQYESSTIEEIDEPRLERVFRTNIFSYFFLTRHALKHMKEGSSIINTTSVNAYKGNASLLDYTATKGAIVAFT 203          
BLAST of CD859707 vs. SwissProt
Match: GRDH2_ARATH (Glucose and ribitol dehydrogenase homolog 2 OS=Arabidopsis thaliana GN=At3g05260 PE=2 SV=1)

HSP 1 Score: 261.151 bits (666), Expect = 3.869e-69
Identity = 128/200 (64.00%), Postives = 165/200 (82.50%), Query Frame = 3
Query:   87 PPQSQKAQPGKEYLMEPLPQSINPNHKPSNKLRGKVALVTGGDSGIGRAVSLIFAKEGATVAFTYVKGHEEIDKDETLKMLLEAKTSDSQEPLAIAADIGYDDNCKQVIELVVKEYGHIDILVNNAAEQHLKDSVEEITEEQLERVFRTNIFSNFFLVRHALKHMKEGSSIINSTSVNAYTGQAETLDYTSTKGAIVAFT 686
            PPQ Q+ QPG +++MEP P+  + N+KPSNKL GKVALVTGGDSGIG+AV   +A EGA+VAFTYVKG E+ D +ETL++L E KT +++EP+ IA D+G+++NCK+V+E VV  +G ID+LVN AAEQH + S+E+I E +LERVFRTNIFS FFLV++ALKHMKEGSSIIN+TSV AY G +  L+YT+TKGAIV+FT
Sbjct:    6 PPQKQETQPGIQHVMEPTPEFSSSNYKPSNKLHGKVALVTGGDSGIGKAVCHCYALEGASVAFTYVKGREDKDAEETLRLLHEVKTREAKEPIMIATDLGFEENCKRVVEEVVNSFGRIDVLVNCAAEQH-EVSIEDIDEARLERVFRTNIFSQFFLVKYALKHMKEGSSIINTTSVVAYAGNSSLLEYTATKGAIVSFT 204          
BLAST of CD859707 vs. SwissProt
Match: GRDH_ORYSJ (Glucose and ribitol dehydrogenase homolog OS=Oryza sativa subsp. japonica GN=Os05g0140800 PE=2 SV=2)

HSP 1 Score: 245.358 bits (625), Expect = 2.197e-64
Identity = 125/210 (59.52%), Postives = 164/210 (78.10%), Query Frame = 3
Query:   87 PPQSQKAQPGKEYLMEPLPQSINPNHKPSNKLRGKVALVTGGDSGIGRAVSLIFAKEGATVAFTYVKGHEEIDKDETLKMLLEAKT-SDSQEPLAIAADIGYDDNCKQVIELVVKEY-GHIDILVNNAAEQHLKDSVEEITEEQLERVFRTNIFSNFFLVRHALKHMKE--------GSSIINSTSVNAYTGQAETLDYTSTKGAIVAFT 686
            PPQ+Q+ QPGKE+ M+P P++I  ++KP+NKL+ KVA+VTGGDSGIGRAV L FA EGATVAFTYVKG EE D +ETL+ L + +  + +++P+AI AD+GYDDNC++V++ V   Y G IDILVNNAAEQ+ + S+ +ITE+ LERVFRTNIFS FF+ +HA+K M++        G SIIN++S+NAY G    LDYT+TKGAIVAFT
Sbjct:    7 PPQNQETQPGKEHAMDPRPEAIIQSYKPANKLKDKVAIVTGGDSGIGRAVCLCFALEGATVAFTYVKGQEEKDAEETLRALRDIRARTGAKDPMAIPADLGYDDNCRKVVDEVAGAYGGAIDILVNNAAEQYERPSITDITEDDLERVFRTNIFSYFFMSKHAVKRMRDRRGGAGAGGCSIINTSSINAYKGNKTLLDYTATKGAIVAFT 216          
BLAST of CD859707 vs. SwissProt
Match: GS39_BACSU (General stress protein 39 OS=Bacillus subtilis GN=ydaD PE=1 SV=3)

HSP 1 Score: 197.978 bits (502), Expect = 4.022e-50
Identity = 102/201 (50.75%), Postives = 139/201 (69.15%), Query Frame = 3
Query:   84 LPPQSQKAQPGKEYLMEPLPQSINPNHKPSNKLRGKVALVTGGDSGIGRAVSLIFAKEGATVAFTYVKGHEEIDKDETLKMLLEAKTSDSQEPLAIAADIGYDDNCKQVIELVVKEYGHIDILVNNAAEQHLKDSVEEITEEQLERVFRTNIFSNFFLVRHALKHMKEGSSIINSTSVNAYTGQAETLDYTSTKGAIVAFT 686
            LP Q+Q  QPG E  M P P     ++K ++KL+GKVAL+TGGDSGIGRAVS+ +AKEGA +A  Y   HE  D +ET K + +    +  + L IA D+G ++ C + +E  VKE G +DILVNNA EQH K+S+++IT EQL R F+TN +S F+L + A+ ++K GS+IIN+TS+N Y G    +DYT+TKGAI AFT
Sbjct:    8 LPAQTQSRQPGIESEMNPSPVYEYEDYKGADKLKGKVALITGGDSGIGRAVSVAYAKEGADIAIVYKDEHE--DAEETKKRVEQ----EGVKCLLIAGDVGEEEFCNEAVEKTVKELGGLDILVNNAGEQHPKESIKDITSEQLHRTFKTNFYSQFYLTKKAIDYLKPGSAIINTTSINPYVGNPTLIDYTATKGAINAFT 202          
BLAST of CD859707 vs. SwissProt
Match: YHDF_BACSU (Uncharacterized oxidoreductase yhdF OS=Bacillus subtilis GN=yhdF PE=3 SV=1)

HSP 1 Score: 196.052 bits (497), Expect = 1.529e-49
Identity = 99/199 (49.75%), Postives = 138/199 (69.35%), Query Frame = 3
Query:   90 PQSQKAQPGKEYLMEPLPQSINPNHKPSNKLRGKVALVTGGDSGIGRAVSLIFAKEGATVAFTYVKGHEEIDKDETLKMLLEAKTSDSQEPLAIAADIGYDDNCKQVIELVVKEYGHIDILVNNAAEQHLKDSVEEITEEQLERVFRTNIFSNFFLVRHALKHMKEGSSIINSTSVNAYTGQAETLDYTSTKGAIVAFT 686
            PQ Q  QPG E  M PLP S + +++ S KL+GKVA++TGGDSGIGRA ++ FAKEGA ++  Y+  H   D +ET K +      ++   L I  D+G +++C+Q ++  V  +G +DILVNNAAEQH +DS+  I+ EQLE+ FRTNIFS F + + AL H++EG +IIN+TS+ AY G    +DY+STKGAIV+FT
Sbjct:   13 PQHQDRQPGIESKMNPLPLSEDEDYRGSGKLKGKVAIITGGDSGIGRAAAIAFAKEGADISILYLDEHS--DAEETRKRI----EKENVRCLLIPGDVGDENHCEQAVQQTVDHFGKLDILVNNAAEQHPQDSILNISTEQLEKTFRTNIFSMFHMTKKALPHLQEGCAIINTTSITAYEGDTALIDYSSTKGAIVSFT 205          
BLAST of CD859707 vs. SwissProt
Match: YHXC_BACSU (Uncharacterized oxidoreductase yhxC OS=Bacillus subtilis GN=yhxC PE=3 SV=2)

HSP 1 Score: 191.815 bits (486), Expect = 2.883e-48
Identity = 104/201 (51.74%), Postives = 135/201 (67.16%), Query Frame = 3
Query:   84 LPPQSQKAQPGKEYLMEPLPQSINPNHKPSNKLRGKVALVTGGDSGIGRAVSLIFAKEGATVAFTYVKGHEEIDKDETLKMLLEAKTSDSQEPLAIAADIGYDDNCKQVIELVVKEYGHIDILVNNAAEQHLKDSVEEITEEQLERVFRTNIFSNFFLVRHALKHMKEGSSIINSTSVNAYTGQAETLDYTSTKGAIVAFT 686
            LPPQ Q  QPG EYLM+P P    P  K + KL GK A++TGGDSGIGRAVS++FAKEGA V   Y+  H+  D +ET K  +E    +  + L IA D+G +  C  V+    + +  IDILVNNAAEQH++ S+E+IT  QL R F+TNIFS F+L +  L H+K+GSSIIN+ S+ AY G    +DY++TKGAIV FT
Sbjct:    9 LPPQHQNQQPGFEYLMDPRPVFDKP--KKAKKLEGKTAIITGGDSGIGRAVSVLFAKEGANVVIVYLNEHQ--DAEET-KQYVE---KEGVKCLLIAGDVGDEAFCNDVVGQASQVFPSIDILVNNAAEQHVQPSIEKITSHQLIRTFQTNIFSMFYLTKAVLPHLKKGSSIINTASITAYKGNKTLIDYSATKGAIVTFT 201          
BLAST of CD859707 vs. SwissProt
Match: YAY8_SCHPO (Uncharacterized oxidoreductase C4H3.08 OS=Schizosaccharomyces pombe GN=SPAC4H3.08 PE=2 SV=1)

HSP 1 Score: 154.066 bits (388), Expect = 6.661e-37
Identity = 86/208 (41.35%), Postives = 129/208 (62.02%), Query Frame = 3
Query:   75 EPMLPPQSQKAQPGKEYLMEPLPQSIN----PNHKPSNKLRGKVALVTGGDSGIGRAVSLIFAKEGATVAFTYVKGHEEIDKDETLKMLLEAKTSDSQEPLAIAADIGYDDNCKQVIELVVKEYGHIDILVNNAAEQHLKDSVEEITEEQLERVFRTNIFSNFFLVRHALKHMKEGSSIINSTSVNAYTGQAETLDYTSTKGAIVAFT 686
            +P+   Q+QK  PGK   ++P P  +       H  S KL  K  L+TGGDSGIG+A +++FA+EG+ +  + +   EE D  E  + L+E    + +        +   DNC+ +++  +K+ G ID+LVNN A Q +  S+E+I +EQ +  F+TNIFS F++ + A+ HMK GSSI+N +S+NAY G+ + LDYTSTKGAI AFT
Sbjct:    2 DPVPSTQTQK-WPGKHADLDPEPSLLRYCDGRVHVGSGKLAEKKTLLTGGDSGIGKAAAVMFAREGSDLVISCLP--EERDDAEVTRDLIER---EGRNCWIWEGKLDKSDNCRDLVDFALKKLGWIDVLVNNIAYQQVAQSIEDIDDEQWDLTFKTNIFSFFWVTKAAISHMKSGSSIVNCSSINAYVGRPDLLDYTSTKGAITAFT 203          
BLAST of CD859707 vs. SwissProt
Match: YHXD_BACSU (Uncharacterized oxidoreductase yhxD OS=Bacillus subtilis GN=yhxD PE=3 SV=2)

HSP 1 Score: 143.28 bits (360), Expect = 1.176e-33
Identity = 79/216 (36.57%), Postives = 130/216 (60.19%), Query Frame = 3
Query:   39 SSVSNPAKMRSNEPMLPPQSQKAQPGKEYLMEPLPQSINPNHKPSNKLRGKVALVTGGDSGIGRAVSLIFAKEGATVAFTYVKGHEEIDKDETLKMLLEAKTSDSQEPLAIAADIGYDDNCKQVIELVVKEYGHIDILVNNAAEQHLKDSVEEITEEQLERVFRTNIFSNFFLVRHALKHMKEGSSIINSTSVNAYTGQAETLDYTSTKGAIVAFT 686
            S+++NP K   ++    P+  +  PG +  M+P+P     ++K S KL G+ ALVTGGDSGIGRA ++ +A+EGA VA  Y+   EE    E +K L+EA   + ++ + I  D+  +  C+ +++    E G +D+L   A +Q   +++E++  EQ+ + F  N+FS +++V+ AL ++ EG+SII +TSV  Y      LDY +TK AI+ FT
Sbjct:    4 SNLTNPIKAFFHDEF--PEQYQEPPGLQKNMKPVPDCGEKSYKGSGKLTGRKALVTGGDSGIGRAAAIAYAREGADVAINYLP--EEQPDAEEVKELIEA---EGRKAVLIPGDLSDESFCQDLVKQSHHELGGLDVLALVAGKQQAVENIEDLPTEQIYKTFEVNVFSLYWVVKAALPYLPEGASIITTTSVEGYNPSPMLLDYAATKNAIIGFT 212          
BLAST of CD859707 vs. SwissProt
Match: YGHA_ECOLI (Uncharacterized oxidoreductase yghA OS=Escherichia coli (strain K12) GN=yghA PE=1 SV=1)

HSP 1 Score: 116.701 bits (291), Expect = 1.179e-25
Identity = 63/199 (31.66%), Postives = 113/199 (56.78%), Query Frame = 3
Query:   90 PQSQKAQPGKEYLMEPLPQSINPNHKPSNKLRGKVALVTGGDSGIGRAVSLIFAKEGATVAFTYVKGHEEIDKDETLKMLLEAKTSDSQEPLAIAADIGYDDNCKQVIELVVKEYGHIDILVNNAAEQHLKDSVEEITEEQLERVFRTNIFSNFFLVRHALKHMKEGSSIINSTSVNAYTGQAETLDYTSTKGAIVAFT 686
            P+ ++  PG +  M P+P      +  S +L+ + ALVTGGDSGIGRA ++ +A+EGA VA +Y+   EE D  +  K++ E      ++ + +  D+  +   + ++    K  G +DI+   A +Q     + ++T EQ ++ F  N+F+ F+L + A+  + +G+SII ++S+ AY      LDY +TK AI+ ++
Sbjct:   17 PKQKQPTPGIQAKMTPVPDCGEKTYVGSGRLKDRKALVTGGDSGIGRAAAIAYAREGADVAISYLPVEEE-DAQDVKKIIEEC----GRKAVLLPGDLSDEKFARSLVHEAHKALGGLDIMALVAGKQVAIPDIADLTSEQFQKTFAINVFALFWLTQEAIPLLPKGASIITTSSIQAYQPSPHLLDYAATKAAILNYS 210          
BLAST of CD859707 vs. TAIR peptide
Match: AT1G54870.1 (| Symbols: | NAD(P)-binding Rossmann-fold superfamily protein | chr1:20459011-20460417 FORWARD LENGTH=335)

HSP 1 Score: 281.567 bits (719), Expect = 2.795e-76
Identity = 139/198 (70.20%), Postives = 164/198 (82.83%), Query Frame = 3
Query:   93 QSQKAQPGKEYLMEPLPQSINPNHKPSNKLRGKVALVTGGDSGIGRAVSLIFAKEGATVAFTYVKGHEEIDKDETLKMLLEAKTSDSQEPLAIAADIGYDDNCKQVIELVVKEYGHIDILVNNAAEQHLKDSVEEITEEQLERVFRTNIFSNFFLVRHALKHMKEGSSIINSTSVNAYTGQAETLDYTSTKGAIVAFT 686
            Q Q AQPGKE++ME  PQ  + +++PSNKLRGKVAL+TGGDSGIGRAV   FA EGATVAFTYVKG EE D  ETL+ML E KTSDS+EP+AI  D+G+D+NCK+V++ VV  +G ID+L+NNAAEQ+   ++EEI E +LERVFRTNIFS FFL RHALKHMKEGSSIIN+TSVNAY G A  LDYT+TKGAIVAFT
Sbjct:   53 QKQHAQPGKEHVMESSPQFSSSDYQPSNKLRGKVALITGGDSGIGRAVGYCFASEGATVAFTYVKGQEEKDAQETLQMLKEVKTSDSKEPIAIPTDLGFDENCKRVVDEVVNAFGRIDVLINNAAEQYESSTIEEIDEPRLERVFRTNIFSYFFLTRHALKHMKEGSSIINTTSVNAYKGNASLLDYTATKGAIVAFT 250          
BLAST of CD859707 vs. TAIR peptide
Match: AT3G05260.1 (| Symbols: | NAD(P)-binding Rossmann-fold superfamily protein | chr3:1497665-1498919 REVERSE LENGTH=289)

HSP 1 Score: 261.151 bits (666), Expect = 3.909e-70
Identity = 128/200 (64.00%), Postives = 165/200 (82.50%), Query Frame = 3
Query:   87 PPQSQKAQPGKEYLMEPLPQSINPNHKPSNKLRGKVALVTGGDSGIGRAVSLIFAKEGATVAFTYVKGHEEIDKDETLKMLLEAKTSDSQEPLAIAADIGYDDNCKQVIELVVKEYGHIDILVNNAAEQHLKDSVEEITEEQLERVFRTNIFSNFFLVRHALKHMKEGSSIINSTSVNAYTGQAETLDYTSTKGAIVAFT 686
            PPQ Q+ QPG +++MEP P+  + N+KPSNKL GKVALVTGGDSGIG+AV   +A EGA+VAFTYVKG E+ D +ETL++L E KT +++EP+ IA D+G+++NCK+V+E VV  +G ID+LVN AAEQH + S+E+I E +LERVFRTNIFS FFLV++ALKHMKEGSSIIN+TSV AY G +  L+YT+TKGAIV+FT
Sbjct:    6 PPQKQETQPGIQHVMEPTPEFSSSNYKPSNKLHGKVALVTGGDSGIGKAVCHCYALEGASVAFTYVKGREDKDAEETLRLLHEVKTREAKEPIMIATDLGFEENCKRVVEEVVNSFGRIDVLVNCAAEQH-EVSIEDIDEARLERVFRTNIFSQFFLVKYALKHMKEGSSIINTTSVVAYAGNSSLLEYTATKGAIVSFT 204          
BLAST of CD859707 vs. TAIR peptide
Match: AT4G05530.1 (| Symbols: IBR1, SDRA | indole-3-butyric acid response 1 | chr4:2816462-2818074 FORWARD LENGTH=254)

HSP 1 Score: 81.2629 bits (199), Expect = 5.544e-16
Identity = 52/174 (29.89%), Postives = 88/174 (50.57%), Query Frame = 3
Query:  165 KPSNKLRGKVALVTGGDSGIGRAVSLIFAKEGATVAFTYVKGHEEIDKDETLKMLLEAKTSDSQEPLAIAADIGYDDNCKQVIELVVKEYGHIDILVNNAAEQHLKDSVEEITEEQLERVFRTNIFSNFFLVRHALKHMKEGSSIINSTSVNAYTGQAETLDYTSTKGAIVAFT 686
            K   +L GKVA+VT    GIG  ++  F  EGA+V    V   ++ + DE +  L     S   +   I   +    + + ++E  V++YG IDI+V NAA     D +    E  L++++  N+ S+  L++    H+++GSS+I  TS+  ++ Q     Y  TK A++  T
Sbjct:    4 KLPRRLEGKVAIVTASTQGIGFGITERFGLEGASVV---VSSRKQANVDEAVAKL----KSKGIDAYGIVCHVSNAQHRRNLVEKTVQKYGKIDIVVCNAAANPSTDPILSSKEAVLDKLWEINVKSSILLLQDMAPHLEKGSSVIFITSIAGFSPQGAMAMYGVTKTALLGLT 170          
BLAST of CD859707 vs. TAIR peptide
Match: AT3G51680.1 (| Symbols: | NAD(P)-binding Rossmann-fold superfamily protein | chr3:19173622-19174667 REVERSE LENGTH=303)

HSP 1 Score: 80.1073 bits (196), Expect = 1.235e-15
Identity = 57/178 (32.02%), Postives = 90/178 (50.56%), Query Frame = 3
Query:  177 KLRGKVALVTGGDSGIGRAVSLIFAKEGATVAFTYVKGHEEIDKDETLKMLLEAKTSDSQEPLA--IAADIGYDDNCKQVIELVVKEYGHIDILVNNA---AEQHLKDSVEEITEEQLERVFRTNIFSNFFLVRHALKHM-KEG--SSIINSTSVNAYTGQAETLDYTSTKGAIVAFT 686
            +L GKVA++TGG  GIG+A  ++FA+ GATV    V   + +      K L   KTS    P+   I+ D+  + + + ++ + V  YG +DIL NNA    +Q    S+ +   ++ + V R N+      ++H  + M K G    II++ SV    G      YT++K AIV  T
Sbjct:   31 RLEGKVAIITGGAHGIGKATVMLFARHGATVVIADV---DNVAGSSLAKSLSSHKTS----PMVAFISCDVSVEADVENLVNVTVARYGRLDILFNNAGVLGDQKKHKSILDFDADEFDHVMRVNVRGVGLGMKHGARAMIKRGFKGCIISTASVAGVMGGMGPHAYTASKHAIVGLT 201          
BLAST of CD859707 vs. TAIR peptide
Match: AT1G52340.1 (| Symbols: ABA2, SIS4, GIN1, SDR1, ISI4, SRE1, ATABA2, ATSDR1 | NAD(P)-binding Rossmann-fold superfamily protein | chr1:19489997-19491527 REVERSE LENGTH=285)

HSP 1 Score: 77.7962 bits (190), Expect = 6.130e-15
Identity = 51/176 (28.98%), Postives = 86/176 (48.86%), Query Frame = 3
Query:  168 PSNKLRGKVALVTGGDSGIGRAVSLIFAKEGATVAFTYVKGHEEIDKDETLKMLLEAKTSDSQEPLAIAADIGYDDNCKQVIELVVKEYGHIDILVNNAAEQHLK-DSVEEITEEQLERVFRTNIFSNFFLVRHALKHM--KEGSSIINSTSVNAYTGQAETLDYTSTKGAIVAFT 686
            PS +L GKVAL+TGG +GIG ++  +F K GA V    +   ++    E  K LL  ++ ++     I  D+  +D+    ++  VK +G +DIL+NNA         +   +  + E  F  N+   F  ++HA + M  ++  SI++  SV    G      Y  +K A++  T
Sbjct:   14 PSQRLLGKVALITGGATGIGESIVRLFHKHGAKVCIVDL---QDDLGGEVCKSLLRGESKET--AFFIHGDVRVEDDISNAVDFAVKNFGTLDILINNAGLCGAPCPDIRNYSLSEFEMTFDVNVKGAFLSMKHAARVMIPEKKGSIVSLCSVGGVVGGVGPHSYVGSKHAVLGLT 184          
BLAST of CD859707 vs. TAIR peptide
Match: AT3G26770.1 (| Symbols: | NAD(P)-binding Rossmann-fold superfamily protein | chr3:9845494-9847079 FORWARD LENGTH=306)

HSP 1 Score: 75.0998 bits (183), Expect = 3.973e-14
Identity = 52/169 (30.77%), Postives = 81/169 (47.93%), Query Frame = 3
Query:  171 SNKLRGKVALVTGGDSGIGRAVSLIFAKEGATVAFTYVKGHEEIDKDETLKMLLEAKTSDSQEPLAIAADIGYDDNCKQVIELVVKEYGHIDILVNNA--AEQHLKDSVEEITEEQLERVFRTNIFSNFFLVRHALKHMKEGSS--IINSTSVNAYTGQAETLDYTSTK 665
            S KL GKVAL+TGG SG+G+A +  F + GA V         ++D +   K   E       E   +  D+  + +    +E+ V+ YG +D++ NNA         S+ ++   + ERV R N+F     ++HA K M    S  I+ ++SV   TG      YT +K
Sbjct:   38 SKKLEGKVALITGGASGLGKATASEFLRHGARVVIA------DLDAETGTKTAKEL----GSEAEFVRCDVTVEADIAGAVEMTVERYGKLDVMYNNAGIVGPMTPASISQLDMTEFERVMRINVFGVVSGIKHAAKFMIPARSGCILCTSSVAGVTGGLAPHSYTISK 196          
BLAST of CD859707 vs. TAIR peptide
Match: AT5G50700.1 (| Symbols: HSD1 | hydroxysteroid dehydrogenase 1 | chr5:20623259-20624995 REVERSE LENGTH=349)

HSP 1 Score: 73.9442 bits (180), Expect = 8.851e-14
Identity = 47/174 (27.01%), Postives = 92/174 (52.87%), Query Frame = 3
Query:  171 SNKLRGKVALVTGGDSGIGRAVSLIFAKEGATVAFTYVKGHEEIDKDETLKMLLEAKTSDSQEPLAIAADIGYDDNCKQVIELVVKEYGHIDILVNNAAEQHLK--DSVEEITEEQLERVFRTNIFSNFFLVRHALKHMKEGS-SIINSTSVNAYTGQAETLDYTSTKGAIVAF 683
            S  L GKV L+TG  SGIG  ++  +A  GA +A T  +      K+   ++   A+   S   + + AD+   D+C+++++  +  +G +D LVNNA    +   +++E+IT  + + V  TN + + +  R AL ++++ +  I+  +S  A+        Y ++K A+++F
Sbjct:   42 SENLYGKVVLITGASSGIGEQLAYEYACRGACLALTARR------KNRLEEVAEIARELGSPNVVTVHADVSKPDDCRRIVDDTITHFGRLDHLVNNAGMTQISMFENIEDIT--RTKAVLDTNFWGSVYTTRAALPYLRQSNGKIVAMSSSAAWLTAPRMSFYNASKAALLSF 207          
BLAST of CD859707 vs. TAIR peptide
Match: AT5G50600.1 (| Symbols: ATHSD1, HSD1 | hydroxysteroid dehydrogenase 1 | chr5:20589917-20591653 REVERSE LENGTH=349)

HSP 1 Score: 73.9442 bits (180), Expect = 8.851e-14
Identity = 47/174 (27.01%), Postives = 92/174 (52.87%), Query Frame = 3
Query:  171 SNKLRGKVALVTGGDSGIGRAVSLIFAKEGATVAFTYVKGHEEIDKDETLKMLLEAKTSDSQEPLAIAADIGYDDNCKQVIELVVKEYGHIDILVNNAAEQHLK--DSVEEITEEQLERVFRTNIFSNFFLVRHALKHMKEGS-SIINSTSVNAYTGQAETLDYTSTKGAIVAF 683
            S  L GKV L+TG  SGIG  ++  +A  GA +A T  +      K+   ++   A+   S   + + AD+   D+C+++++  +  +G +D LVNNA    +   +++E+IT  + + V  TN + + +  R AL ++++ +  I+  +S  A+        Y ++K A+++F
Sbjct:   42 SENLYGKVVLITGASSGIGEQLAYEYACRGACLALTARR------KNRLEEVAEIARELGSPNVVTVHADVSKPDDCRRIVDDTITHFGRLDHLVNNAGMTQISMFENIEDIT--RTKAVLDTNFWGSVYTTRAALPYLRQSNGKIVAMSSSAAWLTAPRMSFYNASKAALLSF 207          
BLAST of CD859707 vs. TAIR peptide
Match: AT3G12800.1 (| Symbols: SDRB, DECR | short-chain dehydrogenase-reductase B | chr3:4063463-4064757 REVERSE LENGTH=298)

HSP 1 Score: 73.9442 bits (180), Expect = 8.851e-14
Identity = 52/179 (29.05%), Postives = 90/179 (50.28%), Query Frame = 3
Query:  180 LRGKVALVTGGDSGIGRAVSLIFAKEGATVAFTYVKGHEEIDKDETLKMLLEAKTSDSQEPLAIAADIGYDDNCKQVIELVVKEYGHIDILVNNAAEQHLKDSVEEITEEQLERVFRTNIFSNFFLVRHALKHMKEGS----------SIINSTSVNAYTGQAETLDYTSTKGAIVAFT 686
            +RG+VAL+TGG SGIG  +S  F K GA++A   + G     + + L   + A  S   + + +  D+   ++ ++V+E   + +G +DILVN AA   L  + E+++      V   +    F +   ALK++K+G+          SIIN ++   YT     +  ++ K A+ A T
Sbjct:   10 VRGQVALITGGGSGIGFEISSQFGKHGASIA---IMGR----RKQVLDDAVSALRSLGIQAIGLEGDVRKQEDARRVVEATFQHFGKLDILVNAAAGNFLA-AAEDLSPNGFRTVLDIDAVGTFNMCHAALKYLKKGAPGRDSSSGGGSIINISATLHYTASWYQIHVSAAKAAVDATT 180          
BLAST of CD859707 vs. TAIR peptide
Match: AT1G63380.1 (| Symbols: | NAD(P)-binding Rossmann-fold superfamily protein | chr1:23505582-23506504 FORWARD LENGTH=282)

HSP 1 Score: 72.7886 bits (177), Expect = 1.972e-13
Identity = 49/187 (26.20%), Postives = 98/187 (52.41%), Query Frame = 3
Query:  144 QSINPNHKPSNKLRGKVALVTGGDSGIGRAVSLIFAKEGATVAFTYVKGHEEIDKDETLKMLLEAKTSDSQEPLAIAADIGYD-DNCKQVIELVVKEYGHIDILVNNAAEQHLKDSVEEITEEQLERVFRTNIFSNFFLVRHA---LKHMKEGSSIINSTSVNA-YTGQAE-TLDYTSTKGAIVAFT 686
            Q++    +P  +L+ KV LVTG  SGIGR + L   K G  +    V     +D+  +L   + +  +   + +A+  D+  + D  ++ ++   + +G ID+L+NNA  +    S  +++EE+ ++VFRTN+  ++ + ++    ++  + G S+IN +S++  + G     L Y  +KG +   T
Sbjct:    5 QTVLKQLEPWCELKDKVVLVTGASSGIGREICLDLCKAGCKI----VAAARRVDRLNSLCSEINSFGAIGVQAVALELDVSSEADTIRKAVKEAWETFGKIDVLINNAGIRGNVKSSLDLSEEEWDKVFRTNLTGSWLISKYVCLLMRDAERGGSVINVSSISGLHRGLLRGGLAYACSKGGVDTMT 187          
The following BLAST results are available for this feature:
BLAST of CD859707 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Trembl)
Total hits: 10
Match NameE-valueIdentityDescription
C6TKH0_SOYBN2.923e-8878.95Putative uncharacterized protein OS=Glycine max PE... [more]
Q9LLQ6_SOYBN1.361e-7769.23Seed maturation protein PM34 OS=Glycine max GN=PM3... [more]
C6TAX1_SOYBN8.822e-7768.75Putative uncharacterized protein OS=Glycine max PE... [more]
C6T8W9_SOYBN4.378e-7667.79Putative uncharacterized protein OS=Glycine max PE... [more]
B9RTX3_RICCO3.706e-7570.50Short chain dehydrogenase, putative OS=Ricinus com... [more]
B9I7W9_POPTR1.078e-7467.15Predicted protein OS=Populus trichocarpa GN=POPTRD... [more]
B9RF47_RICCO3.138e-7467.31Short chain dehydrogenase, putative OS=Ricinus com... [more]
Q8GSE7_LUPAN6.990e-7468.42Putative TAG factor protein OS=Lupinus angustifoli... [more]
A5BL99_VITVI1.557e-7368.84Putative uncharacterized protein OS=Vitis vinifera... [more]
B9RTX2_RICCO2.034e-7368.50Short chain dehydrogenase, putative OS=Ricinus com... [more]
back to top
BLAST of CD859707 vs. SwissProt
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Swissprot)
Total hits: 10
Match NameE-valueIdentityDescription
GRDH_DAUCA2.956e-7768.00Glucose and ribitol dehydrogenase OS=Daucus carota... [more]
GRDH1_ARATH2.766e-7570.20Glucose and ribitol dehydrogenase homolog 1 OS=Ara... [more]
GRDH2_ARATH3.869e-6964.00Glucose and ribitol dehydrogenase homolog 2 OS=Ara... [more]
GRDH_ORYSJ2.197e-6459.52Glucose and ribitol dehydrogenase homolog OS=Oryza... [more]
GS39_BACSU4.022e-5050.75General stress protein 39 OS=Bacillus subtilis GN=... [more]
YHDF_BACSU1.529e-4949.75Uncharacterized oxidoreductase yhdF OS=Bacillus su... [more]
YHXC_BACSU2.883e-4851.74Uncharacterized oxidoreductase yhxC OS=Bacillus su... [more]
YAY8_SCHPO6.661e-3741.35Uncharacterized oxidoreductase C4H3.08 OS=Schizosa... [more]
YHXD_BACSU1.176e-3336.57Uncharacterized oxidoreductase yhxD OS=Bacillus su... [more]
YGHA_ECOLI1.179e-2531.66Uncharacterized oxidoreductase yghA OS=Escherichia... [more]
back to top
BLAST of CD859707 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Pisum sativum unigene v1 vs TAIR 10 peptide)
Total hits: 10
Match NameE-valueIdentityDescription
AT1G54870.12.795e-7670.20| Symbols: | NAD(P)-binding Rossmann-fold superfa... [more]
AT3G05260.13.909e-7064.00| Symbols: | NAD(P)-binding Rossmann-fold superfa... [more]
AT4G05530.15.544e-1629.89| Symbols: IBR1, SDRA | indole-3-butyric acid resp... [more]
AT3G51680.11.235e-1532.02| Symbols: | NAD(P)-binding Rossmann-fold superfa... [more]
AT1G52340.16.130e-1528.98| Symbols: ABA2, SIS4, GIN1, SDR1, ISI4, SRE1, ATA... [more]
AT3G26770.13.973e-1430.77| Symbols: | NAD(P)-binding Rossmann-fold superfa... [more]
AT5G50700.18.851e-1427.01| Symbols: HSD1 | hydroxysteroid dehydrogenase 1 |... [more]
AT5G50600.18.851e-1427.01| Symbols: ATHSD1, HSD1 | hydroxysteroid dehydroge... [more]
AT3G12800.18.851e-1429.05| Symbols: SDRB, DECR | short-chain dehydrogenase-... [more]
AT1G63380.11.972e-1326.20| Symbols: | NAD(P)-binding Rossmann-fold superfa... [more]
back to top
InterPro
Analysis Name: InterProScan analysis for Pisum sativum unigene v1
Date Performed: 2010-12-29
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableSEGsegsegcoord: 45..56
score
NoneNo IPR availablePANTHERPTHR19410:SF77OXIDOREDUCTASE, SHORT CHAIN DEHYDROGENASE/REDUCTASEcoord: 30..228
score: 7.3
NoneNo IPR availableSUPERFAMILY51735NAD(P)-binding Rossmann-fold domainscoord: 58..228
score: 3.6
IPR002198Short-chain dehydrogenase/reductase SDRPRINTSPR00080SDRFAMILYcoord: 145..156
score: 2.9e-07coord: 197..205
score: 2.9e-07coord: 217..228
score: 2.9
IPR002198Short-chain dehydrogenase/reductase SDRPANTHERPTHR19410SHORT-CHAIN DEHYDROGENASES/REDUCTASE FAMILY MEMBERcoord: 30..228
score: 7.3
IPR002198Short-chain dehydrogenase/reductase SDRPFAMPF00106adh_shortcoord: 63..228
score: 7.6
IPR002347Glucose/ribitol dehydrogenasePRINTSPR00081GDHRDHcoord: 64..81
score: 3.4e-17coord: 145..156
score: 3.4e-17coord: 191..207
score: 3.4e-17coord: 217..228
score: 3.4
IPR016040NAD(P)-binding domainGENE3D3.40.50.720no descriptioncoord: 53..228
score: 9.8

Properties
Property NameValue
Singlet in analysisPisum sativum unigene v1
Sequences
The following sequences are available for this feature:

EST sequence

>CD859707 ID=CD859707|Name=CD859707|organism=Pisum sativum|type=EST|length=688bp
TCGAGCGCCGCCCGGGCAGGTCTCATACAGTATACTTATCTTCTGTTTCA
AACCCTGCAAAAATGAGAAGTAACGAGCCTATGTTACCACCTCAGAGCCA
GAAAGCTCAACCAGGAAAAGAATATCTAATGGAACCACTACCACAAAGCA
TAAATCCTAACCACAAGCCCTCCAACAAACTAAGGGGAAAGGTGGCGTTG
GTGACAGGAGGTGACTCAGGTATTGGAAGAGCTGTGTCTCTGATATTTGC
AAAAGAAGGTGCAACAGTGGCCTTTACATACGTGAAGGGTCATGAGGAGA
TTGACAAGGATGAAACATTGAAGATGTTGCTAGAAGCCAAGACAAGTGAT
TCACAAGAACCACTGGCAATTGCTGCTGATATTGGATATGATGATAATTG
CAAACAAGTGATAGAACTTGTTGTCAAAGAATATGGTCACATTGATATTC
TTGTCAACAACGCAGCTGAACAGCATCTTAAAGACTCAGTTGAGGAAATC
ACCGAGGAACAGCTTGAAAGAGTCTTCAGGACCAACATCTTTTCAAACTT
CTTTTTGGTCAGGCATGCGTTGAAGCACATGAAAGAAGGTAGTTCAATCA
TAAACTCAACTTCAGTGAACGCGTATACTGGACAAGCGGAAACACTGGAC
TACACTTCGACGAAGGGAGCTATTGTTGCATTCACCAG
back to top
Annotated Terms
The following terms have been associated with this EST:
Vocabulary: Biological Process
TermDefinition
GO:0008152metabolic process
GO:0055114oxidation-reduction process
Vocabulary: Molecular Function
TermDefinition
GO:0016491oxidoreductase activity
GO:0003824catalytic activity
GO:0005488binding
Vocabulary: INTERPRO
TermDefinition
IPR002198DH_sc/Rdtase_SDR
IPR002347SDR_fam
IPR016040NAD(P)-bd_dom