FG528850
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of FG528850 vs. Medicago proteins
Match: IMGA|Medtr5g089680.1 (Unknown Protein (AHRD V1) chr05_pseudomolecule_IMGAG_V3.5 37946872-37947461 E EGN_Mt100125 20100825) HSP 1 Score: 51.9878 bits (123), Expect = 2.632e-7 Identity = 32/88 (36.36%), Postives = 46/88 (52.27%), Query Frame = -2 Query: 40 KLNLDVCLDVKGK*GIEDIFKNENGDSMAACTQFVDEEENLLLMEAVAFNIGINVAKDCCILKVHFESDNETLVKILNGEKDNRTTTR 303 K N D L VKG G+ I +NENG MA+ + E ++L EA + + +A DC ++ FE DNE + + L KDN+ R Sbjct: 38 KANCDANLQVKGWWGLGSIIRNENGLVMASAAWKIKGTEEVILAEAFSLLSTVRLAIDCGFRQMIFEGDNEKVFRTL---KDNKIEDR 122
BLAST of FG528850 vs. Medicago proteins
Match: IMGA|Medtr3g090420.1 (Unknown Protein (AHRD V1) chr03_pseudomolecule_IMGAG_V3.5 30502323-30503079 H EGN_Mt100125 20100825) HSP 1 Score: 50.447 bits (119), Expect = 7.657e-7 Identity = 30/97 (30.93%), Postives = 54/97 (55.67%), Query Frame = -2 Query: 16 KLNLDVCLDVKGK*GIEDIFKNENGDSMAACTQFVDEEENLLLMEAVAFNIGINVAKDCCILKVHFESDNETLVKILNGE-KDNRTTTRLMVMAMKR 303 K N + CL ++G GI + ++ NG +MAA T + +++ L EA + + +A+DC +V FE DNE + + E K+NR+ ++ ++R Sbjct: 86 KANSNTCLQLQGWWGIGAVVRDSNGLAMAATTWKIPGSDSVELAEAYGLLLTMRLARDCGFREVIFEGDNERIWNMACYENKENRSYLGSVIQEIQR 182 The following BLAST results are available for this feature:
BLAST of FG528850 vs. Medicago proteins
Analysis Date: 2011-04-21 (Homology Analysis: Pisum sativum unigene v2 vs Medicago proteins) Total hits: 2
InterPro
Analysis Name: InterProScan analysis for Pisum sativum unigene v2
Date Performed: 2011-04-27
Analysis Name: InterProScan analysis for Pisum sativum unigene v1 Date Performed: 2010-12-29
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >FG528850 ID=FG528850; Name=FG528850; organism=Pisum sativum; type=EST; length=619bpback to top |