FG536116
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of FG536116 vs. Soybean peptides
Match: Glyma03g02510.1|PACid:16250892 () HSP 1 Score: 64.6994 bits (156), Expect = 3.120e-11 Identity = 28/44 (63.64%), Postives = 35/44 (79.55%), Query Frame = 2 Query: 2 MHGFSSGDKSHPESETICRMAESLGLQIIFSKQSRVEEGDWSRE 133 +HGFSSGDKSHPESE IC++AE LGLQ+ K++R EG+W E Sbjct: 728 LHGFSSGDKSHPESENICKIAEFLGLQMKILKENREREGEWYNE 771
BLAST of FG536116 vs. Medicago proteins
Match: IMGA|Medtr8g035960.1 (Pentatricopeptide repeat-containing protein At4g32430, mitochondrial (AHRD V1 ***- Q84MA3); contains Interpro domain(s) IPR002885 Pentatricopeptide repeat chr08_pseudomolecule_IMGAG_V3.5 8213182-8215557 H EGN_Mt100125 20100825) HSP 1 Score: 83.9593 bits (206), Expect = 3.015e-17 Identity = 40/51 (78.43%), Postives = 44/51 (86.27%), Query Frame = 2 Query: 2 MHGFSSGDKSHPESETICRMAESLGLQIIFSKQSRVEEGDWSREFELMSHG 154 +HGFSSGDKSHPESETI RMAE LGLQ+IFSK+S GDW REFEL+SHG Sbjct: 741 LHGFSSGDKSHPESETIDRMAEFLGLQMIFSKESGGTGGDWHREFELVSHG 791
BLAST of FG536116 vs. Medicago proteins
Match: IMGA|AC225458_84.1 (Pentatricopeptide repeat-containing protein At4g32430, mitochondrial (AHRD V1 ***- Q84MA3); contains Interpro domain(s) IPR002885 Pentatricopeptide repeat AC225458.11 291147-288772 H EGN_Mt100125 20100825) HSP 1 Score: 83.9593 bits (206), Expect = 3.015e-17 Identity = 40/51 (78.43%), Postives = 44/51 (86.27%), Query Frame = 2 Query: 2 MHGFSSGDKSHPESETICRMAESLGLQIIFSKQSRVEEGDWSREFELMSHG 154 +HGFSSGDKSHPESETI RMAE LGLQ+IFSK+S GDW REFEL+SHG Sbjct: 741 LHGFSSGDKSHPESETIDRMAEFLGLQMIFSKESGGTGGDWHREFELVSHG 791
BLAST of FG536116 vs. Medicago proteins
Match: IMGA|AC233070_1021.1 (Pentatricopeptide repeat-containing protein At4g32430, mitochondrial (AHRD V1 ***- Q84MA3); contains Interpro domain(s) IPR002885 Pentatricopeptide repeat AC233070.6 106197-108572 H EGN_Mt100125 20100825) HSP 1 Score: 83.9593 bits (206), Expect = 3.015e-17 Identity = 40/51 (78.43%), Postives = 44/51 (86.27%), Query Frame = 2 Query: 2 MHGFSSGDKSHPESETICRMAESLGLQIIFSKQSRVEEGDWSREFELMSHG 154 +HGFSSGDKSHPESETI RMAE LGLQ+IFSK+S GDW REFEL+SHG Sbjct: 741 LHGFSSGDKSHPESETIDRMAEFLGLQMIFSKESGGTGGDWHREFELVSHG 791 The following BLAST results are available for this feature:
BLAST of FG536116 vs. Soybean peptides
Analysis Date: 2011-04-21 (Homology Analysis: Pisum sativum unigene v2 vs Soybean peptides) Total hits: 1
BLAST of FG536116 vs. Medicago proteins
Analysis Date: 2011-04-21 (Homology Analysis: Pisum sativum unigene v2 vs Medicago proteins) Total hits: 3
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >FG536116 ID=FG536116; Name=FG536116; organism=Pisum sativum; type=EST; length=424bpback to top |