FG537289
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of FG537289 vs. TrEMBL
Match: B9HK93_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_765086 PE=4 SV=1) HSP 1 Score: 64.3142 bits (155), Expect = 4.518e-9 Identity = 36/71 (50.70%), Postives = 45/71 (63.38%), Query Frame = 1 Query: 7 DIMRDQSYLFQVFRFMTANSFLMDYPDKPLVYPPVLVKEMG--SEVYDGKKHLHGGKDVVEDGTKGIVEKF 213 DI RD+ L QVFRFM ANSF D+P+KPL +P V+VKE G E+ + K L G++V ED I E F Sbjct: 550 DIKRDKRQLLQVFRFMVANSFFKDWPEKPLKFPSVVVKEDGYEDEIVEKKSSL-VGEEVSEDRNNTIAENF 619
BLAST of FG537289 vs. TrEMBL
Match: A5AVH9_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VITISV_043067 PE=4 SV=1) HSP 1 Score: 60.8474 bits (146), Expect = 4.996e-8 Identity = 35/71 (49.30%), Postives = 43/71 (60.56%), Query Frame = 1 Query: 7 DIMRDQSYLFQVFRFMTANSFLMDYPDKPLVYPPVLVKEMG--SEVYDGKKHLHGGKDVVEDGTKGIVEKF 213 DI RD+ +L QVFRFM NSF D+P+KPL +P V VKE G EV D +K K V + G K E+F Sbjct: 497 DIKRDKRHLLQVFRFMAMNSFFKDWPEKPLKFPLVAVKETGCQGEVVD-RKSSPTSKGVPQGGRKTXAEEF 566
BLAST of FG537289 vs. TAIR peptide
Match: AT5G18440.2 (| Symbols: | FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; EXPRESSED IN: 22 plant structures; EXPRESSED DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s: Nuclear fragile X mental retardation-interacting protein 1, conserved region (InterPro:IPR019496); Has 1333 Blast hits to 1211 proteins in 205 species: Archae - 0; Bacteria - 137; Metazoa - 339; Fungi - 162; Plants - 70; Viruses - 6; Other Eukaryotes - 619 (source: NCBI BLink). | chr5:6113092-6115748 FORWARD LENGTH=470) HSP 1 Score: 55.0694 bits (131), Expect = 1.337e-8 Identity = 29/62 (46.77%), Postives = 37/62 (59.68%), Query Frame = 1 Query: 4 ADIMRDQSYLFQVFRFMTANSFLMDYPDKPLVYPPVLVKEMGSEVYDGKKHLHGGKDVVEDG 189 ADI RD+S L QVFRFM NS L ++P++PL P + VKE G E + G D + DG Sbjct: 395 ADIKRDKSQLLQVFRFMVMNSLLKEFPEQPLKLPLITVKETGCEDAMEDPSIEGLCDGLSDG 456
BLAST of FG537289 vs. TAIR peptide
Match: AT5G18440.1 (| Symbols: | CONTAINS InterPro DOMAIN/s: Nuclear fragile X mental retardation-interacting protein 1, conserved region (InterPro:IPR019496); Has 1333 Blast hits to 1211 proteins in 205 species: Archae - 0; Bacteria - 137; Metazoa - 339; Fungi - 162; Plants - 70; Viruses - 6; Other Eukaryotes - 619 (source: NCBI BLink). | chr5:6113092-6115748 FORWARD LENGTH=470) HSP 1 Score: 55.0694 bits (131), Expect = 1.337e-8 Identity = 29/62 (46.77%), Postives = 37/62 (59.68%), Query Frame = 1 Query: 4 ADIMRDQSYLFQVFRFMTANSFLMDYPDKPLVYPPVLVKEMGSEVYDGKKHLHGGKDVVEDG 189 ADI RD+S L QVFRFM NS L ++P++PL P + VKE G E + G D + DG Sbjct: 395 ADIKRDKSQLLQVFRFMVMNSLLKEFPEQPLKLPLITVKETGCEDAMEDPSIEGLCDGLSDG 456 The following BLAST results are available for this feature:
BLAST of FG537289 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Trembl) Total hits: 2
BLAST of FG537289 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Pisum sativum unigene v1 vs TAIR 10 peptide) Total hits: 2
InterPro
Analysis Name: InterProScan analysis for Pisum sativum unigene v1
Date Performed: 2010-12-29
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >FG537289 ID=FG537289; Name=FG537289; organism=Pisum sativum; type=EST; length=384bpback to top |