FG532959
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of FG532959 vs. TrEMBL
Match: B9RUG9_RICCO (Cation efflux protein/ zinc transporter, putative OS=Ricinus communis GN=RCOM_0852720 PE=4 SV=1) HSP 1 Score: 62.7734 bits (151), Expect = 1.868e-8 Identity = 25/40 (62.50%), Postives = 35/40 (87.50%), Query Frame = 3 Query: 6 IGTLHLHLSTDTDKISIKSQVSHLLHNAGIKDLTLQVECV 125 +GT+HLH+S +TDK S+K + SH+ H+AGIKDLT+QVEC+ Sbjct: 429 VGTMHLHVSAETDKDSMKDRTSHIFHDAGIKDLTVQVECI 468
BLAST of FG532959 vs. TrEMBL
Match: D7TWW5_VITVI (Whole genome shotgun sequence of line PN40024, scaffold_66.assembly12x (Fragment) OS=Vitis vinifera GN=VIT_00032551001 PE=4 SV=1) HSP 1 Score: 61.2326 bits (147), Expect = 5.434e-8 Identity = 28/40 (70.00%), Postives = 35/40 (87.50%), Query Frame = 3 Query: 6 IGTLHLHLSTDTDKISIKSQVSHLLHNAGIKDLTLQVECV 125 +GTLHLH+ST+ DK S K QVS++LH+AGIKDLT+QVE V Sbjct: 561 VGTLHLHISTEADKASTKVQVSNILHDAGIKDLTVQVEYV 600 The following BLAST results are available for this feature:
BLAST of FG532959 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Trembl) Total hits: 2
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >FG532959 ID=FG532959; Name=FG532959; organism=Pisum sativum; type=EST; length=567bpback to top |