FG537017
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of FG537017 vs. TrEMBL
Match: B7FGB0_MEDTR (Putative uncharacterized protein OS=Medicago truncatula PE=4 SV=1) HSP 1 Score: 92.8189 bits (229), Expect = 6.363e-18 Identity = 48/72 (66.67%), Postives = 51/72 (70.83%), Query Frame = -2 Query: 3 PERSFRAFDNGITFHNG*CCCRKLTQAPKSSHSPFTGNFLPSGLCPFHAKAVVERRNRTRHGRILLAESAID 218 P FRAF + IT NG C CRKLTQ+PKSSHSP GN P PFH KAVVE RNRTRHG LLA+SAID Sbjct: 5 PRSQFRAFVDSITCDNGKCFCRKLTQSPKSSHSPLKGNLAPC-FDPFHTKAVVEGRNRTRHGGTLLAKSAID 75 HSP 2 Score: 21.557 bits (44), Expect = 6.363e-18 Identity = 8/9 (88.89%), Postives = 9/9 (100.00%), Query Frame = -1 Query: 205 MVPVPRTQF 231 MVPVPR+QF Sbjct: 1 MVPVPRSQF 9
BLAST of FG537017 vs. TrEMBL
Match: B9N5K8_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_672144 PE=4 SV=1) HSP 1 Score: 63.929 bits (154), Expect = 5.819e-9 Identity = 30/32 (93.75%), Postives = 31/32 (96.88%), Query Frame = 3 Query: 3 INGTLREEDSPMSGSVSPFNNSLGMKRAKTRG 98 +NGTLREE SPMSGSVSPFNNSLGMKRAKTRG Sbjct: 270 LNGTLREEGSPMSGSVSPFNNSLGMKRAKTRG 301
BLAST of FG537017 vs. TrEMBL
Match: A9PGC0_POPTR (Putative uncharacterized protein OS=Populus trichocarpa PE=2 SV=1) HSP 1 Score: 63.929 bits (154), Expect = 5.819e-9 Identity = 30/32 (93.75%), Postives = 31/32 (96.88%), Query Frame = 3 Query: 3 INGTLREEDSPMSGSVSPFNNSLGMKRAKTRG 98 +NGTLREE SPMSGSVSPFNNSLGMKRAKTRG Sbjct: 145 LNGTLREEGSPMSGSVSPFNNSLGMKRAKTRG 176
BLAST of FG537017 vs. TrEMBL
Match: B9GHJ4_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_642696 PE=4 SV=1) HSP 1 Score: 62.3882 bits (150), Expect = 1.693e-8 Identity = 29/32 (90.62%), Postives = 30/32 (93.75%), Query Frame = 3 Query: 3 INGTLREEDSPMSGSVSPFNNSLGMKRAKTRG 98 +NGT REE SPMSGSVSPFNNSLGMKRAKTRG Sbjct: 271 LNGTFREEGSPMSGSVSPFNNSLGMKRAKTRG 302
BLAST of FG537017 vs. TrEMBL
Match: B9T3W9_RICCO (Nucleic acid binding protein, putative OS=Ricinus communis GN=RCOM_0169850 PE=4 SV=1) HSP 1 Score: 62.003 bits (149), Expect = 2.211e-8 Identity = 29/32 (90.62%), Postives = 31/32 (96.88%), Query Frame = 3 Query: 3 INGTLREEDSPMSGSVSPFNNSLGMKRAKTRG 98 +NGTLREE SPMSGSVSPF+NSLGMKRAKTRG Sbjct: 269 LNGTLREEGSPMSGSVSPFHNSLGMKRAKTRG 300
BLAST of FG537017 vs. TrEMBL
Match: D7UAP0_VITVI (Whole genome shotgun sequence of line PN40024, scaffold_15.assembly12x (Fragment) OS=Vitis vinifera GN=VIT_00014762001 PE=4 SV=1) HSP 1 Score: 58.5362 bits (140), Expect = 2.445e-7 Identity = 28/32 (87.50%), Postives = 30/32 (93.75%), Query Frame = 3 Query: 3 INGTLREEDSPMSGSVSPFNNSLGMKRAKTRG 98 +NGTLREE S MSGSVSPF+NSLGMKRAKTRG Sbjct: 256 LNGTLREEGSHMSGSVSPFHNSLGMKRAKTRG 287
BLAST of FG537017 vs. SwissProt
Match: QKIL1_ARATH (KH domain-containing protein At4g26475 OS=Arabidopsis thaliana GN=At4g26475 PE=2 SV=1) HSP 1 Score: 53.9138 bits (128), Expect = 3.763e-7 Identity = 26/32 (81.25%), Postives = 30/32 (93.75%), Query Frame = 3 Query: 3 INGTLREEDSPMSGSVSPFNNSLGMKRAKTRG 98 +NG+LREE SPMSGS+SP+ NSLGMKRAKTRG Sbjct: 278 LNGSLREEGSPMSGSISPY-NSLGMKRAKTRG 308
BLAST of FG537017 vs. SwissProt
Match: QKIL2_ARATH (KH domain-containing protein At5g56140 OS=Arabidopsis thaliana GN=At5g56140 PE=2 SV=1) HSP 1 Score: 53.5286 bits (127), Expect = 4.914e-7 Identity = 27/31 (87.10%), Postives = 29/31 (93.55%), Query Frame = 3 Query: 3 INGTLREEDSPMSGSVSPFNNSLGMKRAKTR 95 +NGTLREE SPMSGSVSP+ NSLGMKRAKTR Sbjct: 284 LNGTLREEGSPMSGSVSPY-NSLGMKRAKTR 313
BLAST of FG537017 vs. TAIR peptide
Match: AT4G26480.1 (| Symbols: | RNA-binding KH domain-containing protein | chr4:13372885-13375793 REVERSE LENGTH=308) HSP 1 Score: 53.9138 bits (128), Expect = 4.498e-8 Identity = 26/32 (81.25%), Postives = 30/32 (93.75%), Query Frame = 3 Query: 3 INGTLREEDSPMSGSVSPFNNSLGMKRAKTRG 98 +NG+LREE SPMSGS+SP+ NSLGMKRAKTRG Sbjct: 278 LNGSLREEGSPMSGSISPY-NSLGMKRAKTRG 308
BLAST of FG537017 vs. TAIR peptide
Match: AT5G56140.1 (| Symbols: | RNA-binding KH domain-containing protein | chr5:22725462-22727932 FORWARD LENGTH=315) HSP 1 Score: 53.5286 bits (127), Expect = 5.875e-8 Identity = 27/31 (87.10%), Postives = 29/31 (93.55%), Query Frame = 3 Query: 3 INGTLREEDSPMSGSVSPFNNSLGMKRAKTR 95 +NGTLREE SPMSGSVSP+ NSLGMKRAKTR Sbjct: 284 LNGTLREEGSPMSGSVSPY-NSLGMKRAKTR 313 The following BLAST results are available for this feature:
BLAST of FG537017 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Trembl) Total hits: 6
BLAST of FG537017 vs. SwissProt
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Swissprot) Total hits: 2
BLAST of FG537017 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Pisum sativum unigene v1 vs TAIR 10 peptide) Total hits: 2
InterPro
Analysis Name: InterProScan analysis for Pisum sativum unigene v1
Date Performed: 2010-12-29
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >FG537017 ID=FG537017; Name=FG537017; organism=Pisum sativum; type=EST; length=459bpback to top |