FG537314
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of FG537314 vs. TrEMBL
Match: Q1RU93_MEDTR (RNA-directed DNA polymerase (Reverse transcriptase); Ribonuclease H; Endonuclease/exonuclease/phosphatase OS=Medicago truncatula GN=MtrDRAFT_AC153123g43v2 PE=4 SV=2) HSP 1 Score: 48.1358 bits (113), Expect = 2.716e-7 Identity = 25/42 (59.52%), Postives = 33/42 (78.57%), Query Frame = 1 Query: 382 LNANSIILILKVKGAENVLDF*PISLANFISKLITKILADRL 507 +N+N I+LI KV GA + D+ PI+LANF K+I+KILADRL Sbjct: 498 INSNLIVLIPKVPGARVMGDYRPIALANFQFKIISKILADRL 539 HSP 2 Score: 30.4166 bits (67), Expect = 2.716e-7 Identity = 12/28 (42.86%), Postives = 22/28 (78.57%), Query Frame = 2 Query: 296 FHRTY*SMMGSDVTLAVQFFFINGKIEE 379 F++TY ++G+DV +VQ FFI+G++ + Sbjct: 469 FYQTYWDIVGADVIQSVQDFFISGQLAQ 496
BLAST of FG537314 vs. TrEMBL
Match: Q1RU93_MEDTR (RNA-directed DNA polymerase (Reverse transcriptase); Ribonuclease H; Endonuclease/exonuclease/phosphatase OS=Medicago truncatula GN=MtrDRAFT_AC153123g43v2 PE=4 SV=2) HSP 1 Score: 48.1358 bits (113), Expect = 3.242e-7 Identity = 25/42 (59.52%), Postives = 33/42 (78.57%), Query Frame = 1 Query: 382 LNANSIILILKVKGAENVLDF*PISLANFISKLITKILADRL 507 +N+N I+LI KV GA + D+ PI+LANF K+I+KILADRL Sbjct: 498 INSNLIVLIPKVPGARVMGDYRPIALANFQFKIISKILADRL 539 HSP 2 Score: 30.4166 bits (67), Expect = 3.242e-7 Identity = 12/28 (42.86%), Postives = 22/28 (78.57%), Query Frame = 2 Query: 296 FHRTY*SMMGSDVTLAVQFFFINGKIEE 379 F++TY ++G+DV +VQ FFI+G++ + Sbjct: 469 FYQTYWDIVGADVIQSVQDFFISGQLAQ 496 The following BLAST results are available for this feature:
BLAST of FG537314 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Trembl) Total hits: 1
BLAST of FG537314 vs. TrEMBL
Analysis Date: 2011-04-27 (Homology Analysis: Pisum sativum unigene v2 vs Trembl) Total hits: 1
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >FG537314 ID=FG537314; Name=FG537314; organism=Pisum sativum; type=EST; length=549bpback to top |