FG537817
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of FG537817 vs. TrEMBL
Match: B9H468_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_759960 PE=4 SV=1) HSP 1 Score: 56.6102 bits (135), Expect = 9.525e-7 Identity = 28/32 (87.50%), Postives = 28/32 (87.50%), Query Frame = 2 Query: 2 IPQTQEKIEHYLSVSKPKLNKLVQAYVEKHQK 97 IP TQEKIE YLSVSKPKL KLVQAYVEK QK Sbjct: 825 IPTTQEKIEQYLSVSKPKLTKLVQAYVEKFQK 856
BLAST of FG537817 vs. SwissProt
Match: C3H38_ARATH (Zinc finger CCCH domain-containing protein 38 OS=Arabidopsis thaliana GN=At3g18640 PE=1 SV=1) HSP 1 Score: 53.9138 bits (128), Expect = 2.950e-7 Identity = 25/32 (78.12%), Postives = 28/32 (87.50%), Query Frame = 2 Query: 2 IPQTQEKIEHYLSVSKPKLNKLVQAYVEKHQK 97 +PQTQEKI+HYLS SKPKL KLVQAYV K +K Sbjct: 644 VPQTQEKIDHYLSASKPKLTKLVQAYVGKIKK 675
BLAST of FG537817 vs. TAIR peptide
Match: AT3G18640.1 (| Symbols: | Zinc finger C-x8-C-x5-C-x3-H type family protein | chr3:6413617-6415829 REVERSE LENGTH=676) HSP 1 Score: 53.9138 bits (128), Expect = 3.699e-8 Identity = 25/32 (78.12%), Postives = 28/32 (87.50%), Query Frame = 2 Query: 2 IPQTQEKIEHYLSVSKPKLNKLVQAYVEKHQK 97 +PQTQEKI+HYLS SKPKL KLVQAYV K +K Sbjct: 644 VPQTQEKIDHYLSASKPKLTKLVQAYVGKIKK 675
BLAST of FG537817 vs. TAIR peptide
Match: AT3G18640.1 (| Symbols: | Zinc finger C-x8-C-x5-C-x3-H type family protein | chr3:6413617-6415829 REVERSE LENGTH=676) HSP 1 Score: 53.9138 bits (128), Expect = 3.699e-8 Identity = 25/32 (78.12%), Postives = 28/32 (87.50%), Query Frame = 2 Query: 2 IPQTQEKIEHYLSVSKPKLNKLVQAYVEKHQK 97 +PQTQEKI+HYLS SKPKL KLVQAYV K +K Sbjct: 644 VPQTQEKIDHYLSASKPKLTKLVQAYVGKIKK 675
BLAST of FG537817 vs. Soybean peptides
Match: Glyma06g15720.1|PACid:16263094 () HSP 1 Score: 62.003 bits (149), Expect = 1.980e-10 Identity = 30/33 (90.91%), Postives = 31/33 (93.94%), Query Frame = 2 Query: 2 IPQTQEKIEHYLSVSKPKLNKLVQAYVEKHQKA 100 IPQTQEKI+HYLS SKPKLNKLVQAYVEK QKA Sbjct: 796 IPQTQEKIDHYLSFSKPKLNKLVQAYVEKVQKA 828
BLAST of FG537817 vs. Soybean peptides
Match: Glyma04g39220.1|PACid:16257245 () HSP 1 Score: 62.003 bits (149), Expect = 1.980e-10 Identity = 30/33 (90.91%), Postives = 31/33 (93.94%), Query Frame = 2 Query: 2 IPQTQEKIEHYLSVSKPKLNKLVQAYVEKHQKA 100 IPQTQEKI+HYLS SKPKLNKLVQAYVEK QKA Sbjct: 384 IPQTQEKIDHYLSFSKPKLNKLVQAYVEKVQKA 416
BLAST of FG537817 vs. SwissProt
Match: C3H38_ARATH (Zinc finger CCCH domain-containing protein 38 OS=Arabidopsis thaliana GN=At3g18640 PE=1 SV=1) HSP 1 Score: 53.9138 bits (128), Expect = 3.004e-7 Identity = 25/32 (78.12%), Postives = 28/32 (87.50%), Query Frame = 2 Query: 2 IPQTQEKIEHYLSVSKPKLNKLVQAYVEKHQK 97 +PQTQEKI+HYLS SKPKL KLVQAYV K +K Sbjct: 644 VPQTQEKIDHYLSASKPKLTKLVQAYVGKIKK 675
BLAST of FG537817 vs. Medicago proteins
Match: IMGA|Medtr8g093480.1 (Zinc finger CCCH domain-containing protein 38 (AHRD V1 *-*- Q9LIH5); contains Interpro domain(s) IPR000571 Zinc finger, CCCH-type chr08_pseudomolecule_IMGAG_V3.5 26789984-26795525 F EGN_Mt100125 20100825) HSP 1 Score: 58.9214 bits (141), Expect = 1.019e-9 Identity = 28/33 (84.85%), Postives = 31/33 (93.94%), Query Frame = 2 Query: 2 IPQTQEKIEHYLSVSKPKLNKLVQAYVEKHQKA 100 IPQT+EKIE YLSVSKPK+NKL+QAYVEK QKA Sbjct: 747 IPQTREKIERYLSVSKPKVNKLIQAYVEKVQKA 779
BLAST of FG537817 vs. Medicago proteins
Match: IMGA|Medtr3g095960.1 (Zinc finger CCCH domain-containing protein 38 (AHRD V1 *-*- Q9LIH5); contains Interpro domain(s) IPR000571 Zinc finger, CCCH-type chr03_pseudomolecule_IMGAG_V3.5 33061387-33070390 E EGN_Mt100125 20100825) HSP 1 Score: 57.3806 bits (137), Expect = 2.964e-9 Identity = 28/32 (87.50%), Postives = 29/32 (90.62%), Query Frame = 2 Query: 2 IPQTQEKIEHYLSVSKPKLNKLVQAYVEKHQK 97 IPQTQEKI+ YLS SKPKLNKLVQAYVEK QK Sbjct: 984 IPQTQEKIDQYLSFSKPKLNKLVQAYVEKVQK 1015 The following BLAST results are available for this feature:
BLAST of FG537817 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Trembl) Total hits: 1
BLAST of FG537817 vs. SwissProt
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Swissprot) Total hits: 1
BLAST of FG537817 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Pisum sativum unigene v1 vs TAIR 10 peptide) Total hits: 1
BLAST of FG537817 vs. TAIR peptide
Analysis Date: 2011-04-21 (Homology Analysis: Pisum sativum unigene v2 vs TAIR 10 peptide) Total hits: 1
BLAST of FG537817 vs. Soybean peptides
Analysis Date: 2011-04-21 (Homology Analysis: Pisum sativum unigene v2 vs Soybean peptides) Total hits: 2
BLAST of FG537817 vs. SwissProt
Analysis Date: 2011-04-21 (Homology Analysis: Pisum sativum unigene v2 vs Swissprot) Total hits: 1
BLAST of FG537817 vs. Medicago proteins
Analysis Date: 2011-04-21 (Homology Analysis: Pisum sativum unigene v2 vs Medicago proteins) Total hits: 2
InterPro
Analysis Name: InterProScan analysis for Pisum sativum unigene v2
Date Performed: 2011-04-27
Analysis Name: InterProScan analysis for Pisum sativum unigene v1 Date Performed: 2010-12-29
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >FG537817 ID=FG537817; Name=FG537817; organism=Pisum sativum; type=EST; length=421bpback to top |