FG533801
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of FG533801 vs. TrEMBL
Match: B9H242_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_1075080 PE=4 SV=1) HSP 1 Score: 67.781 bits (164), Expect = 7.206e-10 Identity = 29/33 (87.88%), Postives = 32/33 (96.97%), Query Frame = 1 Query: 4 KFGWFFVSYMLHIGFCIFAAVAPPIIFKGKSLT 102 +FGWFF+ Y+LHIGFCIFAAVAPPIIFKGKSLT Sbjct: 185 RFGWFFLFYVLHIGFCIFAAVAPPIIFKGKSLT 217
BLAST of FG533801 vs. TrEMBL
Match: C6TGC4_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1) HSP 1 Score: 66.6254 bits (161), Expect = 1.605e-9 Identity = 28/33 (84.85%), Postives = 31/33 (93.94%), Query Frame = 1 Query: 4 KFGWFFVSYMLHIGFCIFAAVAPPIIFKGKSLT 102 KFGWFF+ Y+LHIGFCI AAVAPPI+FKGKSLT Sbjct: 190 KFGWFFLFYLLHIGFCILAAVAPPIVFKGKSLT 222
BLAST of FG533801 vs. TrEMBL
Match: C6TA62_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1) HSP 1 Score: 66.6254 bits (161), Expect = 1.605e-9 Identity = 28/33 (84.85%), Postives = 31/33 (93.94%), Query Frame = 1 Query: 4 KFGWFFVSYMLHIGFCIFAAVAPPIIFKGKSLT 102 KFGWFF+ Y+LHIGFCI AAVAPPI+FKGKSLT Sbjct: 190 KFGWFFMFYLLHIGFCILAAVAPPIVFKGKSLT 222
BLAST of FG533801 vs. TrEMBL
Match: C6T759_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1) HSP 1 Score: 66.6254 bits (161), Expect = 1.605e-9 Identity = 28/33 (84.85%), Postives = 31/33 (93.94%), Query Frame = 1 Query: 4 KFGWFFVSYMLHIGFCIFAAVAPPIIFKGKSLT 102 KFGWFF+ Y+LHIGFCI AAVAPPI+FKGKSLT Sbjct: 212 KFGWFFLFYLLHIGFCILAAVAPPIVFKGKSLT 244
BLAST of FG533801 vs. TrEMBL
Match: B9HYY4_POPTR (Predicted protein (Fragment) OS=Populus trichocarpa GN=POPTRDRAFT_234069 PE=4 SV=1) HSP 1 Score: 66.6254 bits (161), Expect = 1.605e-9 Identity = 28/33 (84.85%), Postives = 31/33 (93.94%), Query Frame = 1 Query: 4 KFGWFFVSYMLHIGFCIFAAVAPPIIFKGKSLT 102 +FGWFF+ Y LHIGFCIFAAVAPPI+FKGKSLT Sbjct: 186 RFGWFFMFYALHIGFCIFAAVAPPIVFKGKSLT 218
BLAST of FG533801 vs. TrEMBL
Match: C6TGL4_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1) HSP 1 Score: 66.2402 bits (160), Expect = 2.097e-9 Identity = 27/33 (81.82%), Postives = 31/33 (93.94%), Query Frame = 1 Query: 4 KFGWFFVSYMLHIGFCIFAAVAPPIIFKGKSLT 102 KFGWFF+ Y+LHIGFCIFAA+APPI+F GKSLT Sbjct: 189 KFGWFFMLYLLHIGFCIFAAIAPPIVFHGKSLT 221
BLAST of FG533801 vs. TrEMBL
Match: C6TC38_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1) HSP 1 Score: 66.2402 bits (160), Expect = 2.097e-9 Identity = 27/33 (81.82%), Postives = 31/33 (93.94%), Query Frame = 1 Query: 4 KFGWFFVSYMLHIGFCIFAAVAPPIIFKGKSLT 102 KFGWFF+ Y+LHIGFCIFAA+APPI+F GKSLT Sbjct: 189 KFGWFFMFYLLHIGFCIFAAIAPPIVFHGKSLT 221
BLAST of FG533801 vs. TrEMBL
Match: C6T8Z0_SOYBN (Putative uncharacterized protein OS=Glycine max PE=4 SV=1) HSP 1 Score: 66.2402 bits (160), Expect = 2.097e-9 Identity = 27/33 (81.82%), Postives = 31/33 (93.94%), Query Frame = 1 Query: 4 KFGWFFVSYMLHIGFCIFAAVAPPIIFKGKSLT 102 KFGWFF+ Y+LHIGFCIFAA+APPI+F GKSLT Sbjct: 8 KFGWFFMLYLLHIGFCIFAAIAPPIVFHGKSLT 40
BLAST of FG533801 vs. TrEMBL
Match: B7FIP0_MEDTR (Putative uncharacterized protein OS=Medicago truncatula PE=2 SV=1) HSP 1 Score: 66.2402 bits (160), Expect = 2.097e-9 Identity = 29/39 (74.36%), Postives = 34/39 (87.18%), Query Frame = 1 Query: 4 KFGWFFVSYMLHIGFCIFAAVAPPIIFKGKSLT*VPSNI 120 KFGWFF+ Y++HIGFCI AAVAPPI+FKGKSLT + S I Sbjct: 213 KFGWFFMLYLVHIGFCILAAVAPPIVFKGKSLTGILSAI 251
BLAST of FG533801 vs. TrEMBL
Match: C6TF49_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1) HSP 1 Score: 65.855 bits (159), Expect = 2.738e-9 Identity = 29/33 (87.88%), Postives = 30/33 (90.91%), Query Frame = 1 Query: 4 KFGWFFVSYMLHIGFCIFAAVAPPIIFKGKSLT 102 KFGWFF+ YMLHI FCI AAVAPPIIFKGKSLT Sbjct: 208 KFGWFFLLYMLHIAFCILAAVAPPIIFKGKSLT 240
BLAST of FG533801 vs. SwissProt
Match: SCAM_PEA (Secretory carrier-associated membrane protein OS=Pisum sativum GN=PSAM2 PE=2 SV=1) HSP 1 Score: 67.3958 bits (163), Expect = 6.658e-11 Identity = 30/39 (76.92%), Postives = 34/39 (87.18%), Query Frame = 1 Query: 4 KFGWFFVSYMLHIGFCIFAAVAPPIIFKGKSLT*VPSNI 120 KFGWFF+ Y+LHIGFCI AAVAPPI+FKGKSLT + S I Sbjct: 190 KFGWFFMFYLLHIGFCILAAVAPPIVFKGKSLTGILSAI 228
BLAST of FG533801 vs. SwissProt
Match: SCAM1_ARATH (Secretory carrier-associated membrane protein 1 OS=Arabidopsis thaliana GN=SCAMP1 PE=1 SV=1) HSP 1 Score: 65.4698 bits (158), Expect = 2.530e-10 Identity = 27/33 (81.82%), Postives = 30/33 (90.91%), Query Frame = 1 Query: 4 KFGWFFVSYMLHIGFCIFAAVAPPIIFKGKSLT 102 KFGWFF +Y+ HI FC+FAAVAPPIIFKGKSLT Sbjct: 184 KFGWFFFTYLFHIAFCVFAAVAPPIIFKGKSLT 216
BLAST of FG533801 vs. SwissProt
Match: SCAM5_ORYSJ (Secretory carrier-associated membrane protein 5 OS=Oryza sativa subsp. japonica GN=SCAMP5 PE=2 SV=1) HSP 1 Score: 64.3142 bits (155), Expect = 5.637e-10 Identity = 25/32 (78.12%), Postives = 30/32 (93.75%), Query Frame = 1 Query: 7 FGWFFVSYMLHIGFCIFAAVAPPIIFKGKSLT 102 FGWFF+ YMLHI FC+FAA+APP+IF+GKSLT Sbjct: 202 FGWFFLCYMLHIAFCVFAAIAPPVIFRGKSLT 233
BLAST of FG533801 vs. SwissProt
Match: SCAM3_ARATH (Secretory carrier-associated membrane protein 3 OS=Arabidopsis thaliana GN=SCAMP3 PE=1 SV=1) HSP 1 Score: 63.1586 bits (152), Expect = 1.256e-9 Identity = 25/31 (80.65%), Postives = 29/31 (93.55%), Query Frame = 1 Query: 7 FGWFFVSYMLHIGFCIFAAVAPPIIFKGKSL 99 FGWFF+ YMLHI FC+FAAVAPP++FKGKSL Sbjct: 192 FGWFFLFYMLHIAFCVFAAVAPPVVFKGKSL 222
BLAST of FG533801 vs. SwissProt
Match: SCAM4_ARATH (Secretory carrier-associated membrane protein 4 OS=Arabidopsis thaliana GN=SCAMP4 PE=2 SV=1) HSP 1 Score: 62.003 bits (149), Expect = 2.797e-9 Identity = 25/33 (75.76%), Postives = 29/33 (87.88%), Query Frame = 1 Query: 4 KFGWFFVSYMLHIGFCIFAAVAPPIIFKGKSLT 102 KFGWFF +Y++HIGFCI AA+APPI F GKSLT Sbjct: 184 KFGWFFFTYLIHIGFCIVAAIAPPIFFHGKSLT 216
BLAST of FG533801 vs. SwissProt
Match: SCAM6_ORYSJ (Secretory carrier-associated membrane protein 6 OS=Oryza sativa subsp. japonica GN=SCAMP6 PE=2 SV=1) HSP 1 Score: 61.6178 bits (148), Expect = 3.654e-9 Identity = 24/32 (75.00%), Postives = 29/32 (90.62%), Query Frame = 1 Query: 7 FGWFFVSYMLHIGFCIFAAVAPPIIFKGKSLT 102 FGWFF+ Y++HIGFCI AA+APPI+F GKSLT Sbjct: 194 FGWFFLCYLIHIGFCIIAAIAPPIVFHGKSLT 225
BLAST of FG533801 vs. SwissProt
Match: SCAM5_ARATH (Secretory carrier-associated membrane protein 5 OS=Arabidopsis thaliana GN=SCAMP5 PE=2 SV=2) HSP 1 Score: 61.6178 bits (148), Expect = 3.654e-9 Identity = 26/31 (83.87%), Postives = 29/31 (93.55%), Query Frame = 1 Query: 7 FGWFFVSYMLHIGFCIFAAVAPPIIFKGKSL 99 FGWFF+ YMLHI FC+FAAVAPPI+FKGKSL Sbjct: 194 FGWFFLFYMLHILFCLFAAVAPPIVFKGKSL 224
BLAST of FG533801 vs. SwissProt
Match: SCAM4_ORYSJ (Secretory carrier-associated membrane protein 4 OS=Oryza sativa subsp. japonica GN=SCAMP4 PE=2 SV=1) HSP 1 Score: 56.6102 bits (135), Expect = 1.175e-7 Identity = 22/33 (66.67%), Postives = 29/33 (87.88%), Query Frame = 1 Query: 4 KFGWFFVSYMLHIGFCIFAAVAPPIIFKGKSLT 102 KFGWFF+ Y++HI FC++AAV+P I+F GKSLT Sbjct: 215 KFGWFFLFYLVHIAFCVYAAVSPSILFVGKSLT 247
BLAST of FG533801 vs. SwissProt
Match: SCAM3_ORYSJ (Secretory carrier-associated membrane protein 3 OS=Oryza sativa subsp. japonica GN=SCAMP3 PE=2 SV=1) HSP 1 Score: 56.225 bits (134), Expect = 1.535e-7 Identity = 23/32 (71.88%), Postives = 28/32 (87.50%), Query Frame = 1 Query: 4 KFGWFFVSYMLHIGFCIFAAVAPPIIFKGKSL 99 KFGWFF+ Y++HI FC++AAVAPP FKGKSL Sbjct: 184 KFGWFFLFYLIHIIFCVWAAVAPPFPFKGKSL 215
BLAST of FG533801 vs. SwissProt
Match: SCAM2_ORYSJ (Secretory carrier-associated membrane protein 2 OS=Oryza sativa subsp. japonica GN=SCAMP2 PE=2 SV=1) HSP 1 Score: 55.4546 bits (132), Expect = 2.618e-7 Identity = 23/32 (71.88%), Postives = 28/32 (87.50%), Query Frame = 1 Query: 4 KFGWFFVSYMLHIGFCIFAAVAPPIIFKGKSL 99 KFGWFF+ Y++HI FCI++AVAPP FKGKSL Sbjct: 188 KFGWFFLFYLIHILFCIWSAVAPPFPFKGKSL 219
BLAST of FG533801 vs. TAIR peptide
Match: AT2G20840.1 (| Symbols: | Secretory carrier membrane protein (SCAMP) family protein | chr2:8971925-8974400 REVERSE LENGTH=282) HSP 1 Score: 65.4698 bits (158), Expect = 2.628e-11 Identity = 27/33 (81.82%), Postives = 30/33 (90.91%), Query Frame = 1 Query: 4 KFGWFFVSYMLHIGFCIFAAVAPPIIFKGKSLT 102 KFGWFF +Y+ HI FC+FAAVAPPIIFKGKSLT Sbjct: 184 KFGWFFFTYLFHIAFCVFAAVAPPIIFKGKSLT 216
BLAST of FG533801 vs. TAIR peptide
Match: AT1G61250.2 (| Symbols: SC3 | secretory carrier 3 | chr1:22586035-22588519 FORWARD LENGTH=274) HSP 1 Score: 63.1586 bits (152), Expect = 1.304e-10 Identity = 25/31 (80.65%), Postives = 29/31 (93.55%), Query Frame = 1 Query: 7 FGWFFVSYMLHIGFCIFAAVAPPIIFKGKSL 99 FGWFF+ YMLHI FC+FAAVAPP++FKGKSL Sbjct: 192 FGWFFLFYMLHIAFCVFAAVAPPVVFKGKSL 222
BLAST of FG533801 vs. TAIR peptide
Match: AT1G61250.1 (| Symbols: SC3 | secretory carrier 3 | chr1:22586035-22588664 FORWARD LENGTH=289) HSP 1 Score: 63.1586 bits (152), Expect = 1.304e-10 Identity = 25/31 (80.65%), Postives = 29/31 (93.55%), Query Frame = 1 Query: 7 FGWFFVSYMLHIGFCIFAAVAPPIIFKGKSL 99 FGWFF+ YMLHI FC+FAAVAPP++FKGKSL Sbjct: 192 FGWFFLFYMLHIAFCVFAAVAPPVVFKGKSL 222
BLAST of FG533801 vs. TAIR peptide
Match: AT1G32050.1 (| Symbols: | SCAMP family protein | chr1:11528616-11530974 FORWARD LENGTH=264) HSP 1 Score: 62.003 bits (149), Expect = 2.905e-10 Identity = 25/33 (75.76%), Postives = 29/33 (87.88%), Query Frame = 1 Query: 4 KFGWFFVSYMLHIGFCIFAAVAPPIIFKGKSLT 102 KFGWFF +Y++HIGFCI AA+APPI F GKSLT Sbjct: 184 KFGWFFFTYLIHIGFCIVAAIAPPIFFHGKSLT 216
BLAST of FG533801 vs. TAIR peptide
Match: AT1G11180.2 (| Symbols: | Secretory carrier membrane protein (SCAMP) family protein | chr1:3745829-3748307 FORWARD LENGTH=304) HSP 1 Score: 61.6178 bits (148), Expect = 3.795e-10 Identity = 26/31 (83.87%), Postives = 29/31 (93.55%), Query Frame = 1 Query: 7 FGWFFVSYMLHIGFCIFAAVAPPIIFKGKSL 99 FGWFF+ YMLHI FC+FAAVAPPI+FKGKSL Sbjct: 207 FGWFFLFYMLHILFCLFAAVAPPIVFKGKSL 237
BLAST of FG533801 vs. TAIR peptide
Match: AT1G11180.1 (| Symbols: | Secretory carrier membrane protein (SCAMP) family protein | chr1:3745829-3748307 FORWARD LENGTH=291) HSP 1 Score: 61.6178 bits (148), Expect = 3.795e-10 Identity = 26/31 (83.87%), Postives = 29/31 (93.55%), Query Frame = 1 Query: 7 FGWFFVSYMLHIGFCIFAAVAPPIIFKGKSL 99 FGWFF+ YMLHI FC+FAAVAPPI+FKGKSL Sbjct: 194 FGWFFLFYMLHILFCLFAAVAPPIVFKGKSL 224
BLAST of FG533801 vs. TAIR peptide
Match: AT1G03550.1 (| Symbols: | Secretory carrier membrane protein (SCAMP) family protein | chr1:885851-887778 REVERSE LENGTH=283) HSP 1 Score: 53.9138 bits (128), Expect = 7.912e-8 Identity = 24/33 (72.73%), Postives = 27/33 (81.82%), Query Frame = 1 Query: 4 KFGWFFVSYMLHIGFCIFAAVAPPIIFKGKSLT 102 KFG FF Y+ HI FC FAAVAPP+IF+GKSLT Sbjct: 185 KFGAFFFFYVFHIAFCGFAAVAPPVIFQGKSLT 217
BLAST of FG533801 vs. TAIR peptide
Match: AT2G20840.1 (| Symbols: | Secretory carrier membrane protein (SCAMP) family protein | chr2:8971925-8974400 REVERSE LENGTH=282) HSP 1 Score: 65.4698 bits (158), Expect = 2.628e-11 Identity = 27/33 (81.82%), Postives = 30/33 (90.91%), Query Frame = 1 Query: 4 KFGWFFVSYMLHIGFCIFAAVAPPIIFKGKSLT 102 KFGWFF +Y+ HI FC+FAAVAPPIIFKGKSLT Sbjct: 184 KFGWFFFTYLFHIAFCVFAAVAPPIIFKGKSLT 216
BLAST of FG533801 vs. TAIR peptide
Match: AT1G61250.2 (| Symbols: SC3 | secretory carrier 3 | chr1:22586035-22588519 FORWARD LENGTH=274) HSP 1 Score: 63.1586 bits (152), Expect = 1.304e-10 Identity = 25/31 (80.65%), Postives = 29/31 (93.55%), Query Frame = 1 Query: 7 FGWFFVSYMLHIGFCIFAAVAPPIIFKGKSL 99 FGWFF+ YMLHI FC+FAAVAPP++FKGKSL Sbjct: 192 FGWFFLFYMLHIAFCVFAAVAPPVVFKGKSL 222
BLAST of FG533801 vs. TAIR peptide
Match: AT1G61250.1 (| Symbols: SC3 | secretory carrier 3 | chr1:22586035-22588664 FORWARD LENGTH=289) HSP 1 Score: 63.1586 bits (152), Expect = 1.304e-10 Identity = 25/31 (80.65%), Postives = 29/31 (93.55%), Query Frame = 1 Query: 7 FGWFFVSYMLHIGFCIFAAVAPPIIFKGKSL 99 FGWFF+ YMLHI FC+FAAVAPP++FKGKSL Sbjct: 192 FGWFFLFYMLHIAFCVFAAVAPPVVFKGKSL 222
BLAST of FG533801 vs. TAIR peptide
Match: AT1G32050.1 (| Symbols: | SCAMP family protein | chr1:11528616-11530974 FORWARD LENGTH=264) HSP 1 Score: 62.003 bits (149), Expect = 2.905e-10 Identity = 25/33 (75.76%), Postives = 29/33 (87.88%), Query Frame = 1 Query: 4 KFGWFFVSYMLHIGFCIFAAVAPPIIFKGKSLT 102 KFGWFF +Y++HIGFCI AA+APPI F GKSLT Sbjct: 184 KFGWFFFTYLIHIGFCIVAAIAPPIFFHGKSLT 216
BLAST of FG533801 vs. TAIR peptide
Match: AT1G11180.2 (| Symbols: | Secretory carrier membrane protein (SCAMP) family protein | chr1:3745829-3748307 FORWARD LENGTH=304) HSP 1 Score: 61.6178 bits (148), Expect = 3.795e-10 Identity = 26/31 (83.87%), Postives = 29/31 (93.55%), Query Frame = 1 Query: 7 FGWFFVSYMLHIGFCIFAAVAPPIIFKGKSL 99 FGWFF+ YMLHI FC+FAAVAPPI+FKGKSL Sbjct: 207 FGWFFLFYMLHILFCLFAAVAPPIVFKGKSL 237
BLAST of FG533801 vs. TAIR peptide
Match: AT1G11180.1 (| Symbols: | Secretory carrier membrane protein (SCAMP) family protein | chr1:3745829-3748307 FORWARD LENGTH=291) HSP 1 Score: 61.6178 bits (148), Expect = 3.795e-10 Identity = 26/31 (83.87%), Postives = 29/31 (93.55%), Query Frame = 1 Query: 7 FGWFFVSYMLHIGFCIFAAVAPPIIFKGKSL 99 FGWFF+ YMLHI FC+FAAVAPPI+FKGKSL Sbjct: 194 FGWFFLFYMLHILFCLFAAVAPPIVFKGKSL 224
BLAST of FG533801 vs. TAIR peptide
Match: AT1G03550.1 (| Symbols: | Secretory carrier membrane protein (SCAMP) family protein | chr1:885851-887778 REVERSE LENGTH=283) HSP 1 Score: 53.9138 bits (128), Expect = 7.912e-8 Identity = 24/33 (72.73%), Postives = 27/33 (81.82%), Query Frame = 1 Query: 4 KFGWFFVSYMLHIGFCIFAAVAPPIIFKGKSLT 102 KFG FF Y+ HI FC FAAVAPP+IF+GKSLT Sbjct: 185 KFGAFFFFYVFHIAFCGFAAVAPPVIFQGKSLT 217
BLAST of FG533801 vs. TrEMBL
Match: B9H242_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_1075080 PE=4 SV=1) HSP 1 Score: 67.781 bits (164), Expect = 8.843e-10 Identity = 29/33 (87.88%), Postives = 32/33 (96.97%), Query Frame = 1 Query: 4 KFGWFFVSYMLHIGFCIFAAVAPPIIFKGKSLT 102 +FGWFF+ Y+LHIGFCIFAAVAPPIIFKGKSLT Sbjct: 185 RFGWFFLFYVLHIGFCIFAAVAPPIIFKGKSLT 217
BLAST of FG533801 vs. TrEMBL
Match: C6TGC4_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1) HSP 1 Score: 66.6254 bits (161), Expect = 1.970e-9 Identity = 28/33 (84.85%), Postives = 31/33 (93.94%), Query Frame = 1 Query: 4 KFGWFFVSYMLHIGFCIFAAVAPPIIFKGKSLT 102 KFGWFF+ Y+LHIGFCI AAVAPPI+FKGKSLT Sbjct: 190 KFGWFFLFYLLHIGFCILAAVAPPIVFKGKSLT 222
BLAST of FG533801 vs. TrEMBL
Match: C6TA62_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1) HSP 1 Score: 66.6254 bits (161), Expect = 1.970e-9 Identity = 28/33 (84.85%), Postives = 31/33 (93.94%), Query Frame = 1 Query: 4 KFGWFFVSYMLHIGFCIFAAVAPPIIFKGKSLT 102 KFGWFF+ Y+LHIGFCI AAVAPPI+FKGKSLT Sbjct: 190 KFGWFFMFYLLHIGFCILAAVAPPIVFKGKSLT 222
BLAST of FG533801 vs. TrEMBL
Match: C6T759_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1) HSP 1 Score: 66.6254 bits (161), Expect = 1.970e-9 Identity = 28/33 (84.85%), Postives = 31/33 (93.94%), Query Frame = 1 Query: 4 KFGWFFVSYMLHIGFCIFAAVAPPIIFKGKSLT 102 KFGWFF+ Y+LHIGFCI AAVAPPI+FKGKSLT Sbjct: 212 KFGWFFLFYLLHIGFCILAAVAPPIVFKGKSLT 244
BLAST of FG533801 vs. TrEMBL
Match: B9HYY4_POPTR (Predicted protein (Fragment) OS=Populus trichocarpa GN=POPTRDRAFT_234069 PE=4 SV=1) HSP 1 Score: 66.6254 bits (161), Expect = 1.970e-9 Identity = 28/33 (84.85%), Postives = 31/33 (93.94%), Query Frame = 1 Query: 4 KFGWFFVSYMLHIGFCIFAAVAPPIIFKGKSLT 102 +FGWFF+ Y LHIGFCIFAAVAPPI+FKGKSLT Sbjct: 186 RFGWFFMFYALHIGFCIFAAVAPPIVFKGKSLT 218
BLAST of FG533801 vs. TrEMBL
Match: C6TGL4_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1) HSP 1 Score: 66.2402 bits (160), Expect = 2.573e-9 Identity = 27/33 (81.82%), Postives = 31/33 (93.94%), Query Frame = 1 Query: 4 KFGWFFVSYMLHIGFCIFAAVAPPIIFKGKSLT 102 KFGWFF+ Y+LHIGFCIFAA+APPI+F GKSLT Sbjct: 189 KFGWFFMLYLLHIGFCIFAAIAPPIVFHGKSLT 221
BLAST of FG533801 vs. TrEMBL
Match: C6TC38_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1) HSP 1 Score: 66.2402 bits (160), Expect = 2.573e-9 Identity = 27/33 (81.82%), Postives = 31/33 (93.94%), Query Frame = 1 Query: 4 KFGWFFVSYMLHIGFCIFAAVAPPIIFKGKSLT 102 KFGWFF+ Y+LHIGFCIFAA+APPI+F GKSLT Sbjct: 189 KFGWFFMFYLLHIGFCIFAAIAPPIVFHGKSLT 221
BLAST of FG533801 vs. TrEMBL
Match: C6T8Z0_SOYBN (Putative uncharacterized protein OS=Glycine max PE=4 SV=1) HSP 1 Score: 66.2402 bits (160), Expect = 2.573e-9 Identity = 27/33 (81.82%), Postives = 31/33 (93.94%), Query Frame = 1 Query: 4 KFGWFFVSYMLHIGFCIFAAVAPPIIFKGKSLT 102 KFGWFF+ Y+LHIGFCIFAA+APPI+F GKSLT Sbjct: 8 KFGWFFMLYLLHIGFCIFAAIAPPIVFHGKSLT 40
BLAST of FG533801 vs. TrEMBL
Match: B7FIP0_MEDTR (Putative uncharacterized protein OS=Medicago truncatula PE=2 SV=1) HSP 1 Score: 66.2402 bits (160), Expect = 2.573e-9 Identity = 29/39 (74.36%), Postives = 34/39 (87.18%), Query Frame = 1 Query: 4 KFGWFFVSYMLHIGFCIFAAVAPPIIFKGKSLT*VPSNI 120 KFGWFF+ Y++HIGFCI AAVAPPI+FKGKSLT + S I Sbjct: 213 KFGWFFMLYLVHIGFCILAAVAPPIVFKGKSLTGILSAI 251
BLAST of FG533801 vs. TrEMBL
Match: C6TF49_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1) HSP 1 Score: 65.855 bits (159), Expect = 3.360e-9 Identity = 29/33 (87.88%), Postives = 30/33 (90.91%), Query Frame = 1 Query: 4 KFGWFFVSYMLHIGFCIFAAVAPPIIFKGKSLT 102 KFGWFF+ YMLHI FCI AAVAPPIIFKGKSLT Sbjct: 208 KFGWFFLLYMLHIAFCILAAVAPPIIFKGKSLT 240
BLAST of FG533801 vs. Lotus protein
Match: chr4.CM0432.580.r2.a (- phase: 0 ) HSP 1 Score: 67.0106 bits (162), Expect = 5.312e-12 Identity = 28/33 (84.85%), Postives = 31/33 (93.94%), Query Frame = 1 Query: 4 KFGWFFVSYMLHIGFCIFAAVAPPIIFKGKSLT 102 KFGWFF+ YM+HIGFCI AAVAPPI+FKGKSLT Sbjct: 205 KFGWFFLFYMIHIGFCILAAVAPPIVFKGKSLT 237
BLAST of FG533801 vs. Lotus protein
Match: LjSGA_019722.1 (- phase: 2 /partial) HSP 1 Score: 66.6254 bits (161), Expect = 6.937e-12 Identity = 29/39 (74.36%), Postives = 34/39 (87.18%), Query Frame = 1 Query: 4 KFGWFFVSYMLHIGFCIFAAVAPPIIFKGKSLT*VPSNI 120 KFGWFF+ Y+LH+GFCI AAVAPPI+FKGKSLT + S I Sbjct: 107 KFGWFFLFYLLHLGFCILAAVAPPIVFKGKSLTGILSAI 145
BLAST of FG533801 vs. Lotus protein
Match: chr3.CM0711.500.r2.d (+ phase: 1 /partial) HSP 1 Score: 64.3142 bits (155), Expect = 3.443e-11 Identity = 27/33 (81.82%), Postives = 30/33 (90.91%), Query Frame = 1 Query: 4 KFGWFFVSYMLHIGFCIFAAVAPPIIFKGKSLT 102 KFGWFF+ Y+ H+ FCIFAAVAPPIIFKGKSLT Sbjct: 52 KFGWFFLCYIWHVAFCIFAAVAPPIIFKGKSLT 84
BLAST of FG533801 vs. Lotus protein
Match: chr2.CM0020.240.r2.m (+ phase: 0 ) HSP 1 Score: 63.5438 bits (153), Expect = 5.873e-11 Identity = 25/33 (75.76%), Postives = 30/33 (90.91%), Query Frame = 1 Query: 4 KFGWFFVSYMLHIGFCIFAAVAPPIIFKGKSLT 102 KFGWFF+ Y+LHI FCIFAA+APP++F GKSLT Sbjct: 188 KFGWFFMFYLLHIAFCIFAAIAPPVVFHGKSLT 220
BLAST of FG533801 vs. Soybean peptides
Match: Glyma13g25460.1|PACid:16291529 () HSP 1 Score: 66.6254 bits (161), Expect = 1.778e-11 Identity = 28/33 (84.85%), Postives = 31/33 (93.94%), Query Frame = 1 Query: 4 KFGWFFVSYMLHIGFCIFAAVAPPIIFKGKSLT 102 KFGWFF+ Y+LHIGFCI AAVAPPI+FKGKSLT Sbjct: 190 KFGWFFMFYLLHIGFCILAAVAPPIVFKGKSLT 222
BLAST of FG533801 vs. Soybean peptides
Match: Glyma07g31090.4|PACid:16268347 () HSP 1 Score: 66.6254 bits (161), Expect = 1.778e-11 Identity = 28/33 (84.85%), Postives = 31/33 (93.94%), Query Frame = 1 Query: 4 KFGWFFVSYMLHIGFCIFAAVAPPIIFKGKSLT 102 KFGWFF+ Y+LHIGFCI AAVAPPI+FKGKSLT Sbjct: 190 KFGWFFLFYLLHIGFCILAAVAPPIVFKGKSLT 222
BLAST of FG533801 vs. Soybean peptides
Match: Glyma07g31090.3|PACid:16268346 () HSP 1 Score: 66.6254 bits (161), Expect = 1.778e-11 Identity = 28/33 (84.85%), Postives = 31/33 (93.94%), Query Frame = 1 Query: 4 KFGWFFVSYMLHIGFCIFAAVAPPIIFKGKSLT 102 KFGWFF+ Y+LHIGFCI AAVAPPI+FKGKSLT Sbjct: 190 KFGWFFLFYLLHIGFCILAAVAPPIVFKGKSLT 222
BLAST of FG533801 vs. Soybean peptides
Match: Glyma07g31090.2|PACid:16268345 () HSP 1 Score: 66.6254 bits (161), Expect = 1.778e-11 Identity = 28/33 (84.85%), Postives = 31/33 (93.94%), Query Frame = 1 Query: 4 KFGWFFVSYMLHIGFCIFAAVAPPIIFKGKSLT 102 KFGWFF+ Y+LHIGFCI AAVAPPI+FKGKSLT Sbjct: 149 KFGWFFLFYLLHIGFCILAAVAPPIVFKGKSLT 181
BLAST of FG533801 vs. Soybean peptides
Match: Glyma07g31090.1|PACid:16268344 () HSP 1 Score: 66.6254 bits (161), Expect = 1.778e-11 Identity = 28/33 (84.85%), Postives = 31/33 (93.94%), Query Frame = 1 Query: 4 KFGWFFVSYMLHIGFCIFAAVAPPIIFKGKSLT 102 KFGWFF+ Y+LHIGFCI AAVAPPI+FKGKSLT Sbjct: 212 KFGWFFLFYLLHIGFCILAAVAPPIVFKGKSLT 244
BLAST of FG533801 vs. Soybean peptides
Match: Glyma09g34400.2|PACid:16277161 () HSP 1 Score: 66.2402 bits (160), Expect = 2.323e-11 Identity = 27/33 (81.82%), Postives = 31/33 (93.94%), Query Frame = 1 Query: 4 KFGWFFVSYMLHIGFCIFAAVAPPIIFKGKSLT 102 KFGWFF+ Y+LHIGFCIFAA+APPI+F GKSLT Sbjct: 189 KFGWFFMFYLLHIGFCIFAAIAPPIVFHGKSLT 221
BLAST of FG533801 vs. Soybean peptides
Match: Glyma09g34400.1|PACid:16277160 () HSP 1 Score: 66.2402 bits (160), Expect = 2.323e-11 Identity = 27/33 (81.82%), Postives = 31/33 (93.94%), Query Frame = 1 Query: 4 KFGWFFVSYMLHIGFCIFAAVAPPIIFKGKSLT 102 KFGWFF+ Y+LHIGFCIFAA+APPI+F GKSLT Sbjct: 189 KFGWFFMFYLLHIGFCIFAAIAPPIVFHGKSLT 221
BLAST of FG533801 vs. Soybean peptides
Match: Glyma01g01380.2|PACid:16243029 () HSP 1 Score: 66.2402 bits (160), Expect = 2.323e-11 Identity = 27/33 (81.82%), Postives = 31/33 (93.94%), Query Frame = 1 Query: 4 KFGWFFVSYMLHIGFCIFAAVAPPIIFKGKSLT 102 KFGWFF+ Y+LHIGFCIFAA+APPI+F GKSLT Sbjct: 189 KFGWFFMLYLLHIGFCIFAAIAPPIVFHGKSLT 221
BLAST of FG533801 vs. Soybean peptides
Match: Glyma01g01380.1|PACid:16243028 () HSP 1 Score: 66.2402 bits (160), Expect = 2.323e-11 Identity = 27/33 (81.82%), Postives = 31/33 (93.94%), Query Frame = 1 Query: 4 KFGWFFVSYMLHIGFCIFAAVAPPIIFKGKSLT 102 KFGWFF+ Y+LHIGFCIFAA+APPI+F GKSLT Sbjct: 189 KFGWFFMLYLLHIGFCIFAAIAPPIVFHGKSLT 221
BLAST of FG533801 vs. Soybean peptides
Match: Glyma12g11820.3|PACid:16287217 () HSP 1 Score: 65.855 bits (159), Expect = 3.034e-11 Identity = 29/33 (87.88%), Postives = 30/33 (90.91%), Query Frame = 1 Query: 4 KFGWFFVSYMLHIGFCIFAAVAPPIIFKGKSLT 102 KFGWFF+ YMLHI FCI AAVAPPIIFKGKSLT Sbjct: 199 KFGWFFLLYMLHIAFCILAAVAPPIIFKGKSLT 231
BLAST of FG533801 vs. SwissProt
Match: SCAM_PEA (Secretory carrier-associated membrane protein OS=Pisum sativum GN=PSAM2 PE=2 SV=1) HSP 1 Score: 67.3958 bits (163), Expect = 6.780e-11 Identity = 30/39 (76.92%), Postives = 34/39 (87.18%), Query Frame = 1 Query: 4 KFGWFFVSYMLHIGFCIFAAVAPPIIFKGKSLT*VPSNI 120 KFGWFF+ Y+LHIGFCI AAVAPPI+FKGKSLT + S I Sbjct: 190 KFGWFFMFYLLHIGFCILAAVAPPIVFKGKSLTGILSAI 228
BLAST of FG533801 vs. SwissProt
Match: SCAM1_ARATH (Secretory carrier-associated membrane protein 1 OS=Arabidopsis thaliana GN=SCAMP1 PE=1 SV=1) HSP 1 Score: 65.4698 bits (158), Expect = 2.576e-10 Identity = 27/33 (81.82%), Postives = 30/33 (90.91%), Query Frame = 1 Query: 4 KFGWFFVSYMLHIGFCIFAAVAPPIIFKGKSLT 102 KFGWFF +Y+ HI FC+FAAVAPPIIFKGKSLT Sbjct: 184 KFGWFFFTYLFHIAFCVFAAVAPPIIFKGKSLT 216
BLAST of FG533801 vs. SwissProt
Match: SCAM5_ORYSJ (Secretory carrier-associated membrane protein 5 OS=Oryza sativa subsp. japonica GN=SCAMP5 PE=2 SV=1) HSP 1 Score: 64.3142 bits (155), Expect = 5.739e-10 Identity = 25/32 (78.12%), Postives = 30/32 (93.75%), Query Frame = 1 Query: 7 FGWFFVSYMLHIGFCIFAAVAPPIIFKGKSLT 102 FGWFF+ YMLHI FC+FAA+APP+IF+GKSLT Sbjct: 202 FGWFFLCYMLHIAFCVFAAIAPPVIFRGKSLT 233
BLAST of FG533801 vs. SwissProt
Match: SCAM3_ARATH (Secretory carrier-associated membrane protein 3 OS=Arabidopsis thaliana GN=SCAMP3 PE=1 SV=1) HSP 1 Score: 63.1586 bits (152), Expect = 1.279e-9 Identity = 25/31 (80.65%), Postives = 29/31 (93.55%), Query Frame = 1 Query: 7 FGWFFVSYMLHIGFCIFAAVAPPIIFKGKSL 99 FGWFF+ YMLHI FC+FAAVAPP++FKGKSL Sbjct: 192 FGWFFLFYMLHIAFCVFAAVAPPVVFKGKSL 222
BLAST of FG533801 vs. SwissProt
Match: SCAM4_ARATH (Secretory carrier-associated membrane protein 4 OS=Arabidopsis thaliana GN=SCAMP4 PE=2 SV=1) HSP 1 Score: 62.003 bits (149), Expect = 2.848e-9 Identity = 25/33 (75.76%), Postives = 29/33 (87.88%), Query Frame = 1 Query: 4 KFGWFFVSYMLHIGFCIFAAVAPPIIFKGKSLT 102 KFGWFF +Y++HIGFCI AA+APPI F GKSLT Sbjct: 184 KFGWFFFTYLIHIGFCIVAAIAPPIFFHGKSLT 216
BLAST of FG533801 vs. SwissProt
Match: SCAM6_ORYSJ (Secretory carrier-associated membrane protein 6 OS=Oryza sativa subsp. japonica GN=SCAMP6 PE=2 SV=1) HSP 1 Score: 61.6178 bits (148), Expect = 3.720e-9 Identity = 24/32 (75.00%), Postives = 29/32 (90.62%), Query Frame = 1 Query: 7 FGWFFVSYMLHIGFCIFAAVAPPIIFKGKSLT 102 FGWFF+ Y++HIGFCI AA+APPI+F GKSLT Sbjct: 194 FGWFFLCYLIHIGFCIIAAIAPPIVFHGKSLT 225
BLAST of FG533801 vs. SwissProt
Match: SCAM5_ARATH (Secretory carrier-associated membrane protein 5 OS=Arabidopsis thaliana GN=SCAMP5 PE=2 SV=2) HSP 1 Score: 61.6178 bits (148), Expect = 3.720e-9 Identity = 26/31 (83.87%), Postives = 29/31 (93.55%), Query Frame = 1 Query: 7 FGWFFVSYMLHIGFCIFAAVAPPIIFKGKSL 99 FGWFF+ YMLHI FC+FAAVAPPI+FKGKSL Sbjct: 194 FGWFFLFYMLHILFCLFAAVAPPIVFKGKSL 224
BLAST of FG533801 vs. SwissProt
Match: SCAM4_ORYSJ (Secretory carrier-associated membrane protein 4 OS=Oryza sativa subsp. japonica GN=SCAMP4 PE=2 SV=1) HSP 1 Score: 56.6102 bits (135), Expect = 1.197e-7 Identity = 22/33 (66.67%), Postives = 29/33 (87.88%), Query Frame = 1 Query: 4 KFGWFFVSYMLHIGFCIFAAVAPPIIFKGKSLT 102 KFGWFF+ Y++HI FC++AAV+P I+F GKSLT Sbjct: 215 KFGWFFLFYLVHIAFCVYAAVSPSILFVGKSLT 247
BLAST of FG533801 vs. SwissProt
Match: SCAM3_ORYSJ (Secretory carrier-associated membrane protein 3 OS=Oryza sativa subsp. japonica GN=SCAMP3 PE=2 SV=1) HSP 1 Score: 56.225 bits (134), Expect = 1.563e-7 Identity = 23/32 (71.88%), Postives = 28/32 (87.50%), Query Frame = 1 Query: 4 KFGWFFVSYMLHIGFCIFAAVAPPIIFKGKSL 99 KFGWFF+ Y++HI FC++AAVAPP FKGKSL Sbjct: 184 KFGWFFLFYLIHIIFCVWAAVAPPFPFKGKSL 215
BLAST of FG533801 vs. SwissProt
Match: SCAM2_ORYSJ (Secretory carrier-associated membrane protein 2 OS=Oryza sativa subsp. japonica GN=SCAMP2 PE=2 SV=1) HSP 1 Score: 55.4546 bits (132), Expect = 2.666e-7 Identity = 23/32 (71.88%), Postives = 28/32 (87.50%), Query Frame = 1 Query: 4 KFGWFFVSYMLHIGFCIFAAVAPPIIFKGKSL 99 KFGWFF+ Y++HI FCI++AVAPP FKGKSL Sbjct: 188 KFGWFFLFYLIHILFCIWSAVAPPFPFKGKSL 219
BLAST of FG533801 vs. Medicago proteins
Match: IMGA|Medtr2g012560.2 (Secretory carrier-associated membrane protein (AHRD V1 ***- Q9ZTX0); contains Interpro domain(s) IPR007273 SCAMP chr02_pseudomolecule_IMGAG_V3.5 3326675-3321197 E EGN_Mt100125 20100825) HSP 1 Score: 66.6254 bits (161), Expect = 1.023e-11 Identity = 29/39 (74.36%), Postives = 34/39 (87.18%), Query Frame = 1 Query: 4 KFGWFFVSYMLHIGFCIFAAVAPPIIFKGKSLT*VPSNI 120 KFGWFF+ Y+LH+GFCI AAVAPPI+FKGKSLT + S I Sbjct: 181 KFGWFFLFYLLHLGFCILAAVAPPIVFKGKSLTGILSAI 219
BLAST of FG533801 vs. Medicago proteins
Match: IMGA|Medtr2g012560.1 (Secretory carrier-associated membrane protein (AHRD V1 ***- Q9ZTX0); contains Interpro domain(s) IPR007273 SCAMP chr02_pseudomolecule_IMGAG_V3.5 3326675-3321197 E EGN_Mt100125 20100825) HSP 1 Score: 66.6254 bits (161), Expect = 1.023e-11 Identity = 29/39 (74.36%), Postives = 34/39 (87.18%), Query Frame = 1 Query: 4 KFGWFFVSYMLHIGFCIFAAVAPPIIFKGKSLT*VPSNI 120 KFGWFF+ Y+LH+GFCI AAVAPPI+FKGKSLT + S I Sbjct: 190 KFGWFFLFYLLHLGFCILAAVAPPIVFKGKSLTGILSAI 228
BLAST of FG533801 vs. Medicago proteins
Match: IMGA|Medtr4g090510.1 (Secretory carrier-associated membrane protein (AHRD V1 ***- Q9ZTX0); contains Interpro domain(s) IPR007273 SCAMP chr04_pseudomolecule_IMGAG_V3.5 30868269-30870158 E EGN_Mt100125 20100825) HSP 1 Score: 66.2402 bits (160), Expect = 1.336e-11 Identity = 29/39 (74.36%), Postives = 34/39 (87.18%), Query Frame = 1 Query: 4 KFGWFFVSYMLHIGFCIFAAVAPPIIFKGKSLT*VPSNI 120 KFGWFF+ Y++HIGFCI AAVAPPI+FKGKSLT + S I Sbjct: 59 KFGWFFMLYLVHIGFCILAAVAPPIVFKGKSLTGILSAI 97
BLAST of FG533801 vs. Medicago proteins
Match: IMGA|Medtr5g027790.1 (Secretory carrier-associated membrane protein 2 (AHRD V1 ***- B7X6S6_TOBAC); contains Interpro domain(s) IPR007273 SCAMP chr05_pseudomolecule_IMGAG_V3.5 11353059-11346856 E EGN_Mt100125 20100825) HSP 1 Score: 61.2326 bits (147), Expect = 4.299e-10 Identity = 24/33 (72.73%), Postives = 29/33 (87.88%), Query Frame = 1 Query: 4 KFGWFFVSYMLHIGFCIFAAVAPPIIFKGKSLT 102 KF WFF+ Y+LHI FCIFAA+APP++F GKSLT Sbjct: 187 KFSWFFMFYLLHIAFCIFAAIAPPVVFHGKSLT 219 The following BLAST results are available for this feature:
BLAST of FG533801 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Trembl) Total hits: 10
BLAST of FG533801 vs. SwissProt
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Swissprot) Total hits: 10
BLAST of FG533801 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Pisum sativum unigene v1 vs TAIR 10 peptide) Total hits: 7
BLAST of FG533801 vs. TAIR peptide
Analysis Date: 2011-04-21 (Homology Analysis: Pisum sativum unigene v2 vs TAIR 10 peptide) Total hits: 7
BLAST of FG533801 vs. TrEMBL
Analysis Date: 2011-04-27 (Homology Analysis: Pisum sativum unigene v2 vs Trembl) Total hits: 10
BLAST of FG533801 vs. Lotus protein
Analysis Date: 2011-04-21 (Homology Analysis: Pisum sativum unigene v2 vs Lotus proteins) Total hits: 4
BLAST of FG533801 vs. Soybean peptides
Analysis Date: 2011-04-21 (Homology Analysis: Pisum sativum unigene v2 vs Soybean peptides) Total hits: 10
BLAST of FG533801 vs. SwissProt
Analysis Date: 2011-04-21 (Homology Analysis: Pisum sativum unigene v2 vs Swissprot) Total hits: 10
BLAST of FG533801 vs. Medicago proteins
Analysis Date: 2011-04-21 (Homology Analysis: Pisum sativum unigene v2 vs Medicago proteins) Total hits: 4
InterPro
Analysis Name: InterProScan analysis for Pisum sativum unigene v2
Date Performed: 2011-04-27
Analysis Name: InterProScan analysis for Pisum sativum unigene v1 Date Performed: 2010-12-29
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >FG533801 ID=FG533801; Name=FG533801; organism=Pisum sativum; type=EST; length=615bpback to top Annotated Terms
The
following terms have been associated with
this EST:
|