FG536086
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of FG536086 vs. TrEMBL
Match: Q7X9S5_GOSBA (Fiber protein Fb15 OS=Gossypium barbadense PE=4 SV=1) HSP 1 Score: 82.8037 bits (203), Expect = 1.215e-14 Identity = 37/46 (80.43%), Postives = 40/46 (86.96%), Query Frame = 3 Query: 3 YSEKYIETDSIQPLLHVLYGGMIFSYLVALPNERRHLAHKEHAESH 140 Y KYIETDSI+PL HV +GGMIFSYLVALPNERRHL HK+HAE H Sbjct: 42 YHAKYIETDSIEPLYHVCFGGMIFSYLVALPNERRHLEHKKHAEQH 87
BLAST of FG536086 vs. TrEMBL
Match: B9SP85_RICCO (Putative uncharacterized protein OS=Ricinus communis GN=RCOM_0594700 PE=4 SV=1) HSP 1 Score: 76.2554 bits (186), Expect = 1.138e-12 Identity = 33/46 (71.74%), Postives = 39/46 (84.78%), Query Frame = 3 Query: 3 YSEKYIETDSIQPLLHVLYGGMIFSYLVALPNERRHLAHKEHAESH 140 Y+EKYI+T SI PL HV +GGMIFSYLVALP ERRHL H++HA+ H Sbjct: 42 YNEKYIQTGSIDPLYHVCFGGMIFSYLVALPEERRHLEHQQHAKEH 87
BLAST of FG536086 vs. TrEMBL
Match: B9IN74_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_579034 PE=4 SV=1) HSP 1 Score: 75.485 bits (184), Expect = 1.941e-12 Identity = 33/46 (71.74%), Postives = 37/46 (80.43%), Query Frame = 3 Query: 3 YSEKYIETDSIQPLLHVLYGGMIFSYLVALPNERRHLAHKEHAESH 140 Y KYIET SI PLLHV YGGMI SYL+ALP ERRHL H++HA+ H Sbjct: 97 YHAKYIETSSIDPLLHVCYGGMILSYLIALPEERRHLEHQQHAKEH 142
BLAST of FG536086 vs. TrEMBL
Match: A9PIP6_9ROSI (Putative uncharacterized protein OS=Populus trichocarpa x Populus deltoides PE=4 SV=1) HSP 1 Score: 75.485 bits (184), Expect = 1.941e-12 Identity = 33/46 (71.74%), Postives = 37/46 (80.43%), Query Frame = 3 Query: 3 YSEKYIETDSIQPLLHVLYGGMIFSYLVALPNERRHLAHKEHAESH 140 Y KYIET SI PLLHV YGGMI SYL+ALP ERRHL H++HA+ H Sbjct: 42 YHAKYIETSSIDPLLHVCYGGMILSYLIALPEERRHLEHQQHAKEH 87
BLAST of FG536086 vs. TrEMBL
Match: Q9SZV4_ARATH (AT4g30010/F6G3_40 OS=Arabidopsis thaliana GN=AT4g30010 PE=1 SV=1) HSP 1 Score: 73.9442 bits (180), Expect = 5.646e-12 Identity = 30/46 (65.22%), Postives = 39/46 (84.78%), Query Frame = 3 Query: 3 YSEKYIETDSIQPLLHVLYGGMIFSYLVALPNERRHLAHKEHAESH 140 Y+EKYI+T S+ P+LH+ + GM FSYLVALPNERRHL H++HA+ H Sbjct: 42 YNEKYIQTSSVDPILHICFYGMAFSYLVALPNERRHLEHQQHAKEH 87
BLAST of FG536086 vs. TrEMBL
Match: D7MCF4_ARALY (Putative uncharacterized protein OS=Arabidopsis lyrata subsp. lyrata GN=ARALYDRAFT_491755 PE=4 SV=1) HSP 1 Score: 73.9442 bits (180), Expect = 5.646e-12 Identity = 30/46 (65.22%), Postives = 39/46 (84.78%), Query Frame = 3 Query: 3 YSEKYIETDSIQPLLHVLYGGMIFSYLVALPNERRHLAHKEHAESH 140 Y+EKYI+T S+ P+LH+ + GM FSYLVALPNERRHL H++HA+ H Sbjct: 42 YNEKYIQTSSVDPILHICFYGMAFSYLVALPNERRHLEHQQHAKEH 87
BLAST of FG536086 vs. TrEMBL
Match: C6T482_SOYBN (Putative uncharacterized protein OS=Glycine max PE=4 SV=1) HSP 1 Score: 73.559 bits (179), Expect = 7.374e-12 Identity = 34/48 (70.83%), Postives = 38/48 (79.17%), Query Frame = 3 Query: 3 YSEKYIETDSIQPLLHVLYGGMIFSYLVALPNERRHLAH-KEHAESHH 143 Y KYIET S P+ HV YGGMIFSYLVALP+ERRHL H +EHA+ HH Sbjct: 42 YHAKYIETSSPDPIFHVCYGGMIFSYLVALPHERRHLQHAQEHAQQHH 89
BLAST of FG536086 vs. TrEMBL
Match: Q5YJM6_HYAOR (Fiber protein (Fragment) OS=Hyacinthus orientalis PE=2 SV=1) HSP 1 Score: 72.7886 bits (177), Expect = 1.258e-11 Identity = 33/48 (68.75%), Postives = 39/48 (81.25%), Query Frame = 3 Query: 3 YSEKYIETDSIQPLLHVLYGGMIFSYLVALPNERRHLAH-KEHAESHH 143 Y EKYI+T S++PL HV GGMIFSYLVALP+ERRHL H ++HA HH Sbjct: 41 YIEKYIDTSSVEPLFHVCIGGMIFSYLVALPHERRHLEHQQQHAAGHH 88
BLAST of FG536086 vs. TrEMBL
Match: A9NXC1_PICSI (Putative uncharacterized protein OS=Picea sitchensis PE=4 SV=1) HSP 1 Score: 71.633 bits (174), Expect = 2.802e-11 Identity = 29/46 (63.04%), Postives = 38/46 (82.61%), Query Frame = 3 Query: 3 YSEKYIETDSIQPLLHVLYGGMIFSYLVALPNERRHLAHKEHAESH 140 Y+ KYI+T SIQPL H++YGG++FSYL ALP ERRHL H++H + H Sbjct: 42 YNAKYIQTSSIQPLNHIVYGGLLFSYLAALPEERRHLEHEKHKKEH 87
BLAST of FG536086 vs. TrEMBL
Match: B9HAZ4_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_652865 PE=4 SV=1) HSP 1 Score: 66.6254 bits (161), Expect = 9.014e-10 Identity = 26/46 (56.52%), Postives = 35/46 (76.09%), Query Frame = 3 Query: 3 YSEKYIETDSIQPLLHVLYGGMIFSYLVALPNERRHLAHKEHAESH 140 Y KYIET S+ P+ HV +GGM+ SY +ALP ERRHL H++H++ H Sbjct: 42 YHAKYIETSSVDPVYHVCFGGMVLSYFLALPEERRHLEHQQHSKEH 87
BLAST of FG536086 vs. TAIR peptide
Match: AT4G30010.1 (| Symbols: | unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: mitochondrion, plastid; EXPRESSED IN: 26 plant structures; EXPRESSED DURING: 15 growth stages; Has 39 Blast hits to 39 proteins in 18 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 39; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). | chr4:14672947-14673219 FORWARD LENGTH=90) HSP 1 Score: 73.9442 bits (180), Expect = 2.222e-14 Identity = 30/46 (65.22%), Postives = 39/46 (84.78%), Query Frame = 3 Query: 3 YSEKYIETDSIQPLLHVLYGGMIFSYLVALPNERRHLAHKEHAESH 140 Y+EKYI+T S+ P+LH+ + GM FSYLVALPNERRHL H++HA+ H Sbjct: 42 YNEKYIQTSSVDPILHICFYGMAFSYLVALPNERRHLEHQQHAKEH 87 The following BLAST results are available for this feature:
BLAST of FG536086 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Trembl) Total hits: 10
BLAST of FG536086 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Pisum sativum unigene v1 vs TAIR 10 peptide) Total hits: 1
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >FG536086 ID=FG536086; Name=FG536086; organism=Pisum sativum; type=EST; length=295bpback to top |