FG530506
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of FG530506 vs. TrEMBL
Match: B9RJ08_RICCO (GTP binding protein, putative OS=Ricinus communis GN=RCOM_1754240 PE=4 SV=1) HSP 1 Score: 58.9214 bits (141), Expect = 2.880e-7 Identity = 27/41 (65.85%), Postives = 30/41 (73.17%), Query Frame = 2 Query: 2 KHHKKPQRAKDRSWRAGKAGKDDSDGMPIARFHQKPVNAGP 124 KHH+KP+R KDRSWR+ DD DGMPI R QKPVNA P Sbjct: 555 KHHRKPKRKKDRSWRSKN---DDGDGMPIIRVFQKPVNASP 592
BLAST of FG530506 vs. TAIR peptide
Match: AT1G08410.1 (| Symbols: | P-loop containing nucleoside triphosphate hydrolases superfamily protein | chr1:2646307-2649106 FORWARD LENGTH=589) HSP 1 Score: 53.9138 bits (128), Expect = 7.063e-8 Identity = 24/44 (54.55%), Postives = 28/44 (63.64%), Query Frame = 2 Query: 2 KHHKKPQRAKDRSWRAGKAGKDDSDGMPIARFHQKPVNAGPLNV 133 K HKKPQR KDR+WR +D DGMP + QKP N GPL + Sbjct: 547 KQHKKPQRKKDRTWRV--QNTEDGDGMPSVKVFQKPANTGPLTM 588 The following BLAST results are available for this feature:
BLAST of FG530506 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Trembl) Total hits: 1
BLAST of FG530506 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Pisum sativum unigene v1 vs TAIR 10 peptide) Total hits: 1
InterPro
Analysis Name: InterProScan analysis for Pisum sativum unigene v1
Date Performed: 2010-12-29
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >FG530506 ID=FG530506; Name=FG530506; organism=Pisum sativum; type=EST; length=578bpback to top |