FG534120
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of FG534120 vs. Lotus protein
Match: chr3.CM0996.530.r2.a (+ phase: 0 ) HSP 1 Score: 62.3882 bits (150), Expect = 7.233e-11 Identity = 28/32 (87.50%), Postives = 30/32 (93.75%), Query Frame = 1 Query: 1 LYDKYIGCMNGTLEEIISLCSSQDHSVAFPML 96 +YD+Y CMNGTLEEIISLCSSQDHSVAFPML Sbjct: 308 VYDRYRDCMNGTLEEIISLCSSQDHSVAFPML 339
BLAST of FG534120 vs. Soybean peptides
Match: Glyma15g41820.1|PACid:16300766 () HSP 1 Score: 55.8398 bits (133), Expect = 1.655e-8 Identity = 25/32 (78.12%), Postives = 28/32 (87.50%), Query Frame = 1 Query: 1 LYDKYIGCMNGTLEEIISLCSSQDHSVAFPML 96 LYD+Y CMNGTLEEIISLC +QD+SV FPML Sbjct: 36 LYDRYRDCMNGTLEEIISLCCTQDNSVPFPML 67
BLAST of FG534120 vs. Medicago proteins
Match: IMGA|Medtr2g064090.1 (NAC domain protein IPR003441 (AHRD V1 ***- B9HYC2_POPTR); contains Interpro domain(s) IPR003441 No apical meristem (NAM) protein chr02_pseudomolecule_IMGAG_V3.5 20350020-20353883 E EGN_Mt100125 20100825) HSP 1 Score: 63.1586 bits (152), Expect = 6.219e-11 Identity = 29/31 (93.55%), Postives = 29/31 (93.55%), Query Frame = 1 Query: 1 LYDKYIGCMNGTLEEIISLCSSQDHSVAFPM 93 LYDKY CMNGTLEEIISLCSSQDHSVAFPM Sbjct: 315 LYDKYRDCMNGTLEEIISLCSSQDHSVAFPM 345 The following BLAST results are available for this feature:
BLAST of FG534120 vs. Lotus protein
Analysis Date: 2011-04-21 (Homology Analysis: Pisum sativum unigene v2 vs Lotus proteins) Total hits: 1
BLAST of FG534120 vs. Soybean peptides
Analysis Date: 2011-04-21 (Homology Analysis: Pisum sativum unigene v2 vs Soybean peptides) Total hits: 1
BLAST of FG534120 vs. Medicago proteins
Analysis Date: 2011-04-21 (Homology Analysis: Pisum sativum unigene v2 vs Medicago proteins) Total hits: 1
InterPro
Analysis Name: InterProScan analysis for Pisum sativum unigene v2
Date Performed: 2011-04-27
Analysis Name: InterProScan analysis for Pisum sativum unigene v1 Date Performed: 2010-12-29
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >FG534120 ID=FG534120; Name=FG534120; organism=Pisum sativum; type=EST; length=448bpback to top |