EX570978
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of EX570978 vs. TrEMBL
Match: A5BZY2_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VITISV_007401 PE=4 SV=1) HSP 1 Score: 83.1889 bits (204), Expect = 9.225e-15 Identity = 38/44 (86.36%), Postives = 43/44 (97.73%), Query Frame = 1 Query: 73 MVDENGEPLTPTSAWRAAEMLAKMAMVKKSLNKVSDLHGFENAR 204 +VDENGEPLTPTSAWRAAE LAK+AM++KS+NKVSDLHGFENAR Sbjct: 713 LVDENGEPLTPTSAWRAAEKLAKVAMMRKSMNKVSDLHGFENAR 756
BLAST of EX570978 vs. TrEMBL
Match: B9R6Q1_RICCO (Protein binding protein, putative OS=Ricinus communis GN=RCOM_1583660 PE=4 SV=1) HSP 1 Score: 81.2629 bits (199), Expect = 3.505e-14 Identity = 37/44 (84.09%), Postives = 43/44 (97.73%), Query Frame = 1 Query: 73 MVDENGEPLTPTSAWRAAEMLAKMAMVKKSLNKVSDLHGFENAR 204 ++DENGEPLTP+SAWRAAE LAK+A++KKSLNKVSDLHGFENAR Sbjct: 723 VIDENGEPLTPSSAWRAAEKLAKVAIMKKSLNKVSDLHGFENAR 766
BLAST of EX570978 vs. TrEMBL
Match: B9GN58_POPTR (Predicted protein (Fragment) OS=Populus trichocarpa GN=POPTRDRAFT_410406 PE=4 SV=1) HSP 1 Score: 79.7221 bits (195), Expect = 1.020e-13 Identity = 37/43 (86.05%), Postives = 41/43 (95.35%), Query Frame = 1 Query: 76 VDENGEPLTPTSAWRAAEMLAKMAMVKKSLNKVSDLHGFENAR 204 +DENGEPLTPTSAWRAAE LAK+A +KKSLN+VSDLHGFENAR Sbjct: 662 MDENGEPLTPTSAWRAAEKLAKVATMKKSLNRVSDLHGFENAR 704
BLAST of EX570978 vs. TrEMBL
Match: D7SSI6_VITVI (Whole genome shotgun sequence of line PN40024, scaffold_205.assembly12x (Fragment) OS=Vitis vinifera GN=VIT_00003713001 PE=4 SV=1) HSP 1 Score: 77.0258 bits (188), Expect = 6.611e-13 Identity = 35/43 (81.40%), Postives = 41/43 (95.35%), Query Frame = 1 Query: 76 VDENGEPLTPTSAWRAAEMLAKMAMVKKSLNKVSDLHGFENAR 204 +DE GEPLTPTSAWRAAE LAK+A+++KSLN+VSDLHGFENAR Sbjct: 613 LDEKGEPLTPTSAWRAAERLAKVAIMRKSLNRVSDLHGFENAR 655
BLAST of EX570978 vs. TrEMBL
Match: Q7XTB9_ORYSJ (OSJNBa0068L06.4 protein OS=Oryza sativa subsp. japonica GN=OSJNBa0068L06.4 PE=4 SV=2) HSP 1 Score: 72.0182 bits (175), Expect = 2.127e-11 Identity = 32/39 (82.05%), Postives = 38/39 (97.44%), Query Frame = 1 Query: 88 GEPLTPTSAWRAAEMLAKMAMVKKSLNKVSDLHGFENAR 204 GEPLTPTSAWRAAE LAK+A+++KS+N+VSDLHGFENAR Sbjct: 685 GEPLTPTSAWRAAEQLAKVAIMRKSMNRVSDLHGFENAR 723
BLAST of EX570978 vs. TrEMBL
Match: Q6MWF9_ORYSJ (B1160F02.17 protein OS=Oryza sativa subsp. japonica GN=B1160F02.17 PE=4 SV=1) HSP 1 Score: 72.0182 bits (175), Expect = 2.127e-11 Identity = 32/39 (82.05%), Postives = 38/39 (97.44%), Query Frame = 1 Query: 88 GEPLTPTSAWRAAEMLAKMAMVKKSLNKVSDLHGFENAR 204 GEPLTPTSAWRAAE LAK+A+++KS+N+VSDLHGFENAR Sbjct: 604 GEPLTPTSAWRAAEQLAKVAIMRKSMNRVSDLHGFENAR 642
BLAST of EX570978 vs. TrEMBL
Match: Q25AL0_ORYSA (H0102C09.6 protein OS=Oryza sativa GN=H0102C09.6 PE=4 SV=1) HSP 1 Score: 72.0182 bits (175), Expect = 2.127e-11 Identity = 32/39 (82.05%), Postives = 38/39 (97.44%), Query Frame = 1 Query: 88 GEPLTPTSAWRAAEMLAKMAMVKKSLNKVSDLHGFENAR 204 GEPLTPTSAWRAAE LAK+A+++KS+N+VSDLHGFENAR Sbjct: 650 GEPLTPTSAWRAAEQLAKVAIMRKSMNRVSDLHGFENAR 688
BLAST of EX570978 vs. TrEMBL
Match: Q0JFI0_ORYSJ (Os04g0101800 protein (Fragment) OS=Oryza sativa subsp. japonica GN=Os04g0101800 PE=4 SV=1) HSP 1 Score: 72.0182 bits (175), Expect = 2.127e-11 Identity = 32/39 (82.05%), Postives = 38/39 (97.44%), Query Frame = 1 Query: 88 GEPLTPTSAWRAAEMLAKMAMVKKSLNKVSDLHGFENAR 204 GEPLTPTSAWRAAE LAK+A+++KS+N+VSDLHGFENAR Sbjct: 564 GEPLTPTSAWRAAEQLAKVAIMRKSMNRVSDLHGFENAR 602
BLAST of EX570978 vs. TrEMBL
Match: C5YB80_SORBI (Putative uncharacterized protein Sb06g000280 OS=Sorghum bicolor GN=Sb06g000280 PE=4 SV=1) HSP 1 Score: 72.0182 bits (175), Expect = 2.127e-11 Identity = 32/39 (82.05%), Postives = 38/39 (97.44%), Query Frame = 1 Query: 88 GEPLTPTSAWRAAEMLAKMAMVKKSLNKVSDLHGFENAR 204 GEPLTPTSAWRAAE LAK+A+++KS+N+VSDLHGFENAR Sbjct: 681 GEPLTPTSAWRAAEQLAKVAIMRKSMNRVSDLHGFENAR 719
BLAST of EX570978 vs. TrEMBL
Match: B9FD01_ORYSJ (Putative uncharacterized protein OS=Oryza sativa subsp. japonica GN=OsJ_13494 PE=4 SV=1) HSP 1 Score: 72.0182 bits (175), Expect = 2.127e-11 Identity = 32/39 (82.05%), Postives = 38/39 (97.44%), Query Frame = 1 Query: 88 GEPLTPTSAWRAAEMLAKMAMVKKSLNKVSDLHGFENAR 204 GEPLTPTSAWRAAE LAK+A+++KS+N+VSDLHGFENAR Sbjct: 618 GEPLTPTSAWRAAEQLAKVAIMRKSMNRVSDLHGFENAR 656
BLAST of EX570978 vs. TAIR peptide
Match: AT4G37890.2 (| Symbols: EDA40 | Zinc finger (C3HC4-type RING finger) family protein | chr4:17812812-17815031 REVERSE LENGTH=711) HSP 1 Score: 68.5514 bits (166), Expect = 1.759e-12 Identity = 31/43 (72.09%), Postives = 38/43 (88.37%), Query Frame = 1 Query: 76 VDENGEPLTPTSAWRAAEMLAKMAMVKKSLNKVSDLHGFENAR 204 V + EPLTPTSAWRAAE LAK+A+++K +N+VSDLHGFENAR Sbjct: 668 VVQKSEPLTPTSAWRAAERLAKVAIMRKHMNRVSDLHGFENAR 710
BLAST of EX570978 vs. TAIR peptide
Match: AT4G37890.1 (| Symbols: EDA40 | Zinc finger (C3HC4-type RING finger) family protein | chr4:17812812-17815031 REVERSE LENGTH=739) HSP 1 Score: 68.5514 bits (166), Expect = 1.759e-12 Identity = 31/43 (72.09%), Postives = 38/43 (88.37%), Query Frame = 1 Query: 76 VDENGEPLTPTSAWRAAEMLAKMAMVKKSLNKVSDLHGFENAR 204 V + EPLTPTSAWRAAE LAK+A+++K +N+VSDLHGFENAR Sbjct: 696 VVQKSEPLTPTSAWRAAERLAKVAIMRKHMNRVSDLHGFENAR 738
BLAST of EX570978 vs. TAIR peptide
Match: AT5G49665.1 (| Symbols: | Zinc finger (C3HC4-type RING finger) family protein | chr5:20167119-20169420 REVERSE LENGTH=740) HSP 1 Score: 67.3958 bits (163), Expect = 3.919e-12 Identity = 33/44 (75.00%), Postives = 37/44 (84.09%), Query Frame = 1 Query: 73 MVDENGEPLTPTSAWRAAEMLAKMAMVKKSLNKVSDLHGFENAR 204 ++DENGEPLTP SAWRAAE LAK+AM+KK SDLHGFENAR Sbjct: 701 LMDENGEPLTPASAWRAAEKLAKLAMMKK-----SDLHGFENAR 739
BLAST of EX570978 vs. TAIR peptide
Match: AT2G22680.1 (| Symbols: | Zinc finger (C3HC4-type RING finger) family protein | chr2:9645433-9647484 FORWARD LENGTH=683) HSP 1 Score: 66.6254 bits (161), Expect = 6.685e-12 Identity = 31/41 (75.61%), Postives = 37/41 (90.24%), Query Frame = 1 Query: 82 ENGEPLTPTSAWRAAEMLAKMAMVKKSLNKVSDLHGFENAR 204 E+ E LTPTSAW+AAE LAK+AMV+K +N+VSDLHGFENAR Sbjct: 642 ESLESLTPTSAWKAAERLAKVAMVRKHMNRVSDLHGFENAR 682
BLAST of EX570978 vs. TAIR peptide
Match: AT5G65683.1 (| Symbols: | Zinc finger (C3HC4-type RING finger) family protein | chr5:26261472-26263704 FORWARD LENGTH=717) HSP 1 Score: 64.6994 bits (156), Expect = 2.540e-11 Identity = 29/45 (64.44%), Postives = 37/45 (82.22%), Query Frame = 1 Query: 70 NMVDENGEPLTPTSAWRAAEMLAKMAMVKKSLNKVSDLHGFENAR 204 N ++ E LTPTSAWRAAE LAK+A+++K LN+VSD+HG ENAR Sbjct: 672 NRTEDKPEQLTPTSAWRAAEKLAKVAIMRKHLNRVSDMHGLENAR 716 The following BLAST results are available for this feature:
BLAST of EX570978 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Trembl) Total hits: 10
BLAST of EX570978 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Pisum sativum unigene v1 vs TAIR 10 peptide) Total hits: 5
InterPro
Analysis Name: InterProScan analysis for Pisum sativum unigene v1
Date Performed: 2010-12-29
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >EX570978 ID=EX570978; Name=EX570978; organism=Pisum sativum; type=EST; length=459bpback to top |