GH720214
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of GH720214 vs. TrEMBL
Match: Q647G5_ARAHY (Oleosin 1 OS=Arachis hypogaea PE=2 SV=2) HSP 1 Score: 76.2554 bits (186), Expect = 1.141e-12 Identity = 35/48 (72.92%), Postives = 44/48 (91.67%), Query Frame = -2 Query: 268 TVPEQVDCVKGRLADVAGYVGQKTKEVGQKTKEVGQDIQTKANEAKRS 411 +VPEQ++ K R+ADVAGYVGQKTK+VGQKTKEVGQ+IQTKA ++KR+ Sbjct: 122 SVPEQLEMAKHRMADVAGYVGQKTKDVGQKTKEVGQEIQTKAQDSKRT 169
BLAST of GH720214 vs. TrEMBL
Match: Q687H7_MEDSC (Putative oleosin protein (Fragment) OS=Medicago scutellata PE=2 SV=1) HSP 1 Score: 67.3958 bits (163), Expect = 5.298e-10 Identity = 32/40 (80.00%), Postives = 37/40 (92.50%), Query Frame = -2 Query: 268 VKGRLADVAGYVGQKTKEVGQKTKEVGQDIQTKANEAKRS 387 V GR+ADV YVGQKTK+VGQKTK+VGQDIQTKA+EAKR+ Sbjct: 33 VPGRMADVFDYVGQKTKDVGQKTKDVGQDIQTKAHEAKRT 72
BLAST of GH720214 vs. SwissProt
Match: OLEO2_SOYBN (P24 oleosin isoform B OS=Glycine max PE=2 SV=1) HSP 1 Score: 58.9214 bits (141), Expect = 9.283e-9 Identity = 28/40 (70.00%), Postives = 33/40 (82.50%), Query Frame = -2 Query: 265 KGRLADVAGYVGQKTKEVGQKTKEVGQDIQTKANEAKRSA 384 K LA+ A YVGQKTKEVGQKTKEVGQDIQ+KA + + +A Sbjct: 147 KHHLAEAAEYVGQKTKEVGQKTKEVGQDIQSKAQDTREAA 186
BLAST of GH720214 vs. SwissProt
Match: OLEO1_SOYBN (P24 oleosin isoform A OS=Glycine max PE=2 SV=2) HSP 1 Score: 58.9214 bits (141), Expect = 9.283e-9 Identity = 28/40 (70.00%), Postives = 33/40 (82.50%), Query Frame = -2 Query: 265 KGRLADVAGYVGQKTKEVGQKTKEVGQDIQTKANEAKRSA 384 K LA+ A YVGQKTKEVGQKTKEVGQDIQ+KA + + +A Sbjct: 148 KHHLAEAAEYVGQKTKEVGQKTKEVGQDIQSKAQDTREAA 187 The following BLAST results are available for this feature:
BLAST of GH720214 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Trembl) Total hits: 2
BLAST of GH720214 vs. SwissProt
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Swissprot) Total hits: 2
InterPro
Analysis Name: InterProScan analysis for Pisum sativum unigene v1
Date Performed: 2010-12-29
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >GH720214 ID=GH720214; Name=GH720214; organism=Pisum sativum; type=EST; length=412bpback to top |