GH720603
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of GH720603 vs. Medicago proteins
Match: IMGA|Medtr2g036290.1 (Narbonin (AHRD V1 ***- Q08884_VICNA); contains Interpro domain(s) IPR001223 Glycoside hydrolase, family 18, catalytic domain chr02_pseudomolecule_IMGAG_V3.5 13124467-13125748 E EGN_Mt100125 20100825) HSP 1 Score: 60.8474 bits (146), Expect = 4.092e-10 Identity = 27/45 (60.00%), Postives = 35/45 (77.78%), Query Frame = 1 Query: 13 LLPGVSTNTTSPLPMTTDIFVKGCTMLLKTASLPGVFVWDANTSS 147 LLPGVST+ S MT D+F+KGC LL++ SLPG+FVW+AN S+ Sbjct: 242 LLPGVSTDPDSNTNMTRDVFIKGCKSLLESESLPGIFVWNANDSA 286
BLAST of GH720603 vs. Medicago proteins
Match: IMGA|Medtr2g036260.1 (Narbonin (AHRD V1 ***- Q08884_VICNA); contains Interpro domain(s) IPR001223 Glycoside hydrolase, family 18, catalytic domain chr02_pseudomolecule_IMGAG_V3.5 13111939-13113270 E EGN_Mt100125 20100825) HSP 1 Score: 60.8474 bits (146), Expect = 4.092e-10 Identity = 27/45 (60.00%), Postives = 35/45 (77.78%), Query Frame = 1 Query: 13 LLPGVSTNTTSPLPMTTDIFVKGCTMLLKTASLPGVFVWDANTSS 147 LLPGVST+ S MT D+F+KGC LL++ SLPG+FVW+AN S+ Sbjct: 242 LLPGVSTDPDSNTNMTRDVFIKGCKSLLESESLPGIFVWNANDSA 286
BLAST of GH720603 vs. Medicago proteins
Match: IMGA|Medtr2g036240.1 (Narbonin (AHRD V1 ***- Q08884_VICNA); contains Interpro domain(s) IPR001223 Glycoside hydrolase, family 18, catalytic domain chr02_pseudomolecule_IMGAG_V3.5 13099414-13100681 E EGN_Mt100125 20100825) HSP 1 Score: 60.8474 bits (146), Expect = 4.092e-10 Identity = 27/45 (60.00%), Postives = 35/45 (77.78%), Query Frame = 1 Query: 13 LLPGVSTNTTSPLPMTTDIFVKGCTMLLKTASLPGVFVWDANTSS 147 LLPGVST+ S MT D+F+KGC LL++ SLPG+FVW+AN S+ Sbjct: 242 LLPGVSTDPDSNTNMTRDVFIKGCKSLLESESLPGIFVWNANDSA 286
BLAST of GH720603 vs. Medicago proteins
Match: IMGA|AC229724_1028.1 (Narbonin (AHRD V1 ***- Q08884_VICNA); contains Interpro domain(s) IPR001223 Glycoside hydrolase, family 18, catalytic domain AC229724.12 93039-91788 F EGN_Mt100125 20100825) HSP 1 Score: 60.8474 bits (146), Expect = 4.092e-10 Identity = 27/45 (60.00%), Postives = 35/45 (77.78%), Query Frame = 1 Query: 13 LLPGVSTNTTSPLPMTTDIFVKGCTMLLKTASLPGVFVWDANTSS 147 LLPGVST+ S MT D+F+KGC LL++ SLPG+FVW+AN S+ Sbjct: 242 LLPGVSTDPDSNTNMTRDVFIKGCKSLLESESLPGIFVWNANDSA 286 The following BLAST results are available for this feature:
BLAST of GH720603 vs. Medicago proteins
Analysis Date: 2011-04-21 (Homology Analysis: Pisum sativum unigene v2 vs Medicago proteins) Total hits: 4
InterPro
Analysis Name: InterProScan analysis for Pisum sativum unigene v2
Date Performed: 2011-04-27
Analysis Name: InterProScan analysis for Pisum sativum unigene v1 Date Performed: 2010-12-29
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >GH720603 ID=GH720603; Name=GH720603; organism=Pisum sativum; type=EST; length=513bpback to top |