CD859854

EST Overview
NameCD859854
Unique NameCD859854
TypeEST
OrganismPisum sativum (pea)
Sequence length587
Libraries
Library NameType
LIBEST_014001 G15cdna_library
Unigenes
This EST is part of the following unigenes:
Unigene NameAnalysis NameSequence type in Unigene
Pisum sativum unigene v2Pisum sativum unigene v2EST
Pisum sativum unigene v1Pisum sativum unigene v1EST
Homology
BLAST of CD859854 vs. TrEMBL
Match: Q9T0P5_PEA (LegA class OS=Pisum sativum GN=legA PE=2 SV=1)

HSP 1 Score: 161.384 bits (407), Expect = 4.229e-38
Identity = 88/141 (62.41%), Postives = 89/141 (63.12%), Query Frame = 3
Query:  165 FLRYXXXXXXXXXXXXXXXXIFSGFKRDFLEDAFNVNRHIVDRLQGRNEDEEKGAIVKVKGGLSIISPPEKQARHQRGSRQEEDEDEEKQPRHQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSQKGKSRRQGD 587
            FL+Y                IFSGFKRDFLEDAFNVNRHIVDRLQGRNEDEEKGAIVKVKGGLSIISPPEKQARHQRGSRQEEDEDEEKQPRHQ                                    SQKGKSRRQGD
Sbjct:  191 FLQYQHQQGGKQEQENEGNNIFSGFKRDFLEDAFNVNRHIVDRLQGRNEDEEKGAIVKVKGGLSIISPPEKQARHQRGSRQEEDEDEEKQPRHQRGSRQEEEEDEDEERQPRHQRRRGEEEEEDKKERGGSQKGKSRRQGD 331          
BLAST of CD859854 vs. TrEMBL
Match: Q41702_VICSA (Legumin A OS=Vicia sativa PE=2 SV=1)

HSP 1 Score: 143.28 bits (360), Expect = 1.192e-32
Identity = 82/143 (57.34%), Postives = 87/143 (60.84%), Query Frame = 3
Query:  165 FLRYXXXXXXXXXXXXXXXXIFSGFKRDFLEDAFNVNRHIVDRLQGRNEDEEKGAIVKVKGGLSIISPPEKQARHQRGSRQEEDED--EEKQPRHQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSQKGKSRRQGD 587
            FLRY                IFSGFKRDFLEDAFNVNRHIVDRLQGRNEDEEKGAIVKVKGGLSII+PPE+QARH+RGSRQEEDED  EE+QP H                                     SQKG+SRRQGD
Sbjct:  191 FLRYQHQQGGKQEQDNDGNNIFSGFKRDFLEDAFNVNRHIVDRLQGRNEDEEKGAIVKVKGGLSIIAPPERQARHERGSRQEEDEDEKEERQPSHH---------------------KSRRDEDEDDKEKRHSQKGQSRRQGD 312          
BLAST of CD859854 vs. TrEMBL
Match: Q99304_VICFA (Legumin A2 primary translation product OS=Vicia faba var. minor GN=LeA2 PE=2 SV=1)

HSP 1 Score: 137.117 bits (344), Expect = 8.540e-31
Identity = 71/97 (73.20%), Postives = 74/97 (76.29%), Query Frame = 3
Query:  165 FLRYXXXXXXXXXXXXXXXXIFSGFKRDFLEDAFNVNRHIVDRLQGRNEDEEKGAIVKVKGGLSIISPPEKQARHQRGSRQEEDED----EEKQPRH 443
            FLRY                IFSGFKRDFLEDA NVNRHIVDRLQGRNEDEEKGAIVKVKGGLSII+PPE+QARH RGSRQEEDED    EE+QP H
Sbjct:  191 FLRYQHQQGGKEEQDNDGNNIFSGFKRDFLEDALNVNRHIVDRLQGRNEDEEKGAIVKVKGGLSIITPPERQARHPRGSRQEEDEDEDEKEERQPSH 287          
BLAST of CD859854 vs. TrEMBL
Match: Q03971_VICFA (N-terminal incomplete legumin A1 pre-pro-polypeptide (Fragment) OS=Vicia faba var. minor GN=LeA1 PE=2 SV=1)

HSP 1 Score: 126.331 bits (316), Expect = 1.508e-27
Identity = 68/99 (68.69%), Postives = 72/99 (72.73%), Query Frame = 3
Query:  165 FLRYXXXXXXXXXXXXXXXXIFSGFKRDFLEDAFNVNRHIVDRLQGRNEDEEKGAIVKVKGGLSIISPPEKQARHQRGSRQEEDED------EEKQPRH 443
            FLRY                IFSGF RDFLEDAFNVNRHIVDRLQGRNE  E+GAIVKVKGGLSII+PPE+QARH RGSRQEEDED      EE+QP H
Sbjct:  184 FLRYQHRQGVKEEQDNDGNNIFSGFNRDFLEDAFNVNRHIVDRLQGRNE--ERGAIVKVKGGLSIITPPERQARHPRGSRQEEDEDEDEDEKEERQPSH 280          
BLAST of CD859854 vs. TrEMBL
Match: Q41676_VICNA (Legumin A OS=Vicia narbonensis PE=2 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 1.276e-26
Identity = 67/93 (72.04%), Postives = 70/93 (75.27%), Query Frame = 3
Query:  165 FLRYXXXXXXXXXXXXXXXXIFSGFKRDFLEDAFNVNRHIVDRLQGRNEDEEKGAIVKVKGGLSIISPPEKQARHQRGSRQEEDED--EEKQP 437
            FLRY                IFSGFKRDFLEDA NVNRHIVDRLQGRNEDEEKGAIVKVKGGLSII+PPE+    QRGSRQEEDED  EE+QP
Sbjct:  191 FLRYQREQGGKQEQENDGNNIFSGFKRDFLEDALNVNRHIVDRLQGRNEDEEKGAIVKVKGGLSIITPPER----QRGSRQEEDEDEKEERQP 279          
BLAST of CD859854 vs. TrEMBL
Match: B5U8K6_LOTJA (Legumin storage protein 5 OS=Lotus japonicus GN=llp5 PE=2 SV=1)

HSP 1 Score: 104.375 bits (259), Expect = 6.135e-21
Identity = 50/94 (53.19%), Postives = 70/94 (74.47%), Query Frame = 3
Query:  165 FLRYXXXXXXXXXXXXXXXXIFSGFKRDFLEDAFNVNRHIVDRLQGRNEDEEKGAIVKVKGGLSIISPPEKQARHQRGSRQEEDEDEEKQPRHQ 446
            FL+Y                IFSGF  +FLEDA N++R+IV +LQGR+E+++KGAIV+VKGGLS+I+PPE+Q+ H+RGS +EEDE+E++  RHQ
Sbjct:  190 FLQYQRQEVRGREEENQGGNIFSGFGGEFLEDALNIDRNIVHKLQGRDEEQDKGAIVRVKGGLSVITPPERQS-HRRGSEEEEDEEEDRPSRHQ 282          
BLAST of CD859854 vs. TrEMBL
Match: C6TGG8_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 6.348e-18
Identity = 42/56 (75.00%), Postives = 50/56 (89.29%), Query Frame = -2
Query:    2 RNTKIPFLGNVYLMLSDITIYQIDVPSSVVKPGESGISIVASGVSCNLSMNWYYDY 169
            +  KIP +GNVY++LS+ITIY IDVPSS VKPGE+GISI+ASGV+CNLSMNWYY Y
Sbjct:   63 KTAKIPVVGNVYMVLSNITIYHIDVPSSHVKPGETGISIIASGVTCNLSMNWYYSY 118          
BLAST of CD859854 vs. TrEMBL
Match: D7TEG9_VITVI (Whole genome shotgun sequence of line PN40024, scaffold_59.assembly12x (Fragment) OS=Vitis vinifera GN=VIT_00030539001 PE=4 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 2.760e-13
Identity = 33/57 (57.89%), Postives = 46/57 (80.70%), Query Frame = -2
Query:    2 RRNTKIPFLGNVYLMLSDITIYQIDVPSSVVKPGESGISIVASGVSCNLSMNWYYDY 172
            +++ KIPFLG V +  S+ITIY IDV SS + PG++G++I+ASG +CNLSMNW+Y Y
Sbjct:   63 KKSVKIPFLGRVDIAFSNITIYHIDVSSSNIAPGDTGVAIIASGTTCNLSMNWHYSY 119          
BLAST of CD859854 vs. TrEMBL
Match: D7KE97_ARALY (Putative uncharacterized protein OS=Arabidopsis lyrata subsp. lyrata GN=ARALYDRAFT_887673 PE=4 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 6.149e-13
Identity = 33/56 (58.93%), Postives = 47/56 (83.93%), Query Frame = -2
Query:    2 RNTKIPFLGNVYLMLSDITIYQIDVPSSVVKPGESGISIVASGVSCNLSMNWYYDY 169
            ++ KIPFLG + +++S++TIY++DV SS VK GE+G+ IVASG +CNLSMNW+Y Y
Sbjct:   63 KSVKIPFLGGIDVVVSNLTIYELDVASSYVKLGETGVVIVASGTTCNLSMNWHYSY 118          
BLAST of CD859854 vs. TrEMBL
Match: C7EA92_SOYBN (Mutant glycinin subunit A1aB1b OS=Glycine max GN=Gy1 PE=2 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 6.149e-13
Identity = 37/70 (52.86%), Postives = 49/70 (70.00%), Query Frame = 3
Query:  225 IFSGFKRDFLEDAFNVNRHIVDRLQGRNEDEEKGAIVKVKGGLSIISPPEKQARHQRGSRQEEDEDEEKQ 434
            I SGF  +FLE AF+V++ I   LQG NE E+KGAIV VKGGLS+I PP  + + +    +EE+EDE+ Q
Sbjct:  220 ILSGFTLEFLEHAFSVDKQIAKNLQGENEGEDKGAIVTVKGGLSVIKPPTDEQQQRPQEEEEEEEDEKPQ 289          
BLAST of CD859854 vs. SwissProt
Match: LEGA_PEA (Legumin A OS=Pisum sativum GN=LEGA PE=1 SV=1)

HSP 1 Score: 160.229 bits (404), Expect = 6.846e-39
Identity = 87/141 (61.70%), Postives = 89/141 (63.12%), Query Frame = 3
Query:  165 FLRYXXXXXXXXXXXXXXXXIFSGFKRDFLEDAFNVNRHIVDRLQGRNEDEEKGAIVKVKGGLSIISPPEKQARHQRGSRQEEDEDEEKQPRHQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSQKGKSRRQGD 587
            FL+Y                IFSGFKRD+LEDAFNVNRHIVDRLQGRNEDEEKGAIVKVKGGLSIISPPEKQARHQRGSRQEEDEDEEKQPRHQ                                    SQKGKSRRQGD
Sbjct:  191 FLQYQHQQGGKQEQENEGNNIFSGFKRDYLEDAFNVNRHIVDRLQGRNEDEEKGAIVKVKGGLSIISPPEKQARHQRGSRQEEDEDEEKQPRHQRGSRQEEEEDEDEERQPRHQRRRGEEEEEDKKERGGSQKGKSRRQGD 331          
BLAST of CD859854 vs. SwissProt
Match: LEGA2_PEA (Legumin A2 OS=Pisum sativum GN=LEGA2 PE=3 SV=1)

HSP 1 Score: 156.762 bits (395), Expect = 7.569e-38
Identity = 88/143 (61.54%), Postives = 89/143 (62.24%), Query Frame = 3
Query:  165 FLRYXXXXXXXXXXXXXXXXIFSGFKRDFLEDAFNVNRHIVDRLQGRNEDEEKGAIVKVKGGLSIISPPEKQARHQRGSRQE--EDEDEEKQPRHQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSQKGKSRRQGD 587
            FLRY                IFSGFKRDFLEDAFNVNRHIVDRLQGRNEDEEKGAIVKVKGGLSIISPPEKQARHQRGSRQE  EDEDEE+QPRHQ                                    SQKGKSRRQGD
Sbjct:  192 FLRYQHQQGGKQEQENEGNNIFSGFKRDFLEDAFNVNRHIVDRLQGRNEDEEKGAIVKVKGGLSIISPPEKQARHQRGSRQEEDEDEDEERQPRHQRGSRQEEEEDEDEERQPRHQRRRGEEEEEDKKERRGSQKGKSRRQGD 334          
BLAST of CD859854 vs. SwissProt
Match: LEG_CICAR (Legumin OS=Cicer arietinum GN=leg3 PE=1 SV=1)

HSP 1 Score: 120.168 bits (300), Expect = 7.851e-27
Identity = 60/75 (80.00%), Postives = 67/75 (89.33%), Query Frame = 3
Query:  225 IFSGFKRDFLEDAFNVNRHIVDRLQGRNEDEEKGAIVKVKGGLSIISPPEKQARHQRGSRQEEDEDE-EKQPRHQ 446
            IFSGFKRDFLEDA NVNR IV++LQGRNEDEEKGAIVKVKGGLSI +PPEK+ R +RGSRQEEDEDE EK+  H+
Sbjct:  209 IFSGFKRDFLEDALNVNRRIVNKLQGRNEDEEKGAIVKVKGGLSITTPPEKEPRQKRGSRQEEDEDEDEKRQPHR 283          
BLAST of CD859854 vs. SwissProt
Match: GLYG3_SOYBN (Glycinin G3 OS=Glycine max GN=GY3 PE=3 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 4.468e-14
Identity = 41/74 (55.41%), Postives = 53/74 (71.62%), Query Frame = 3
Query:  225 IFSGFKRDFLEDAFNVNRHIVDRLQGRNEDEEKGAIVKVKGGLSIISPPEKQARHQRGSRQEEDEDEEKQPRHQ 446
            I SGF  +FLE AF V+R IV +LQG NE+EEKGAIV VKGGLS+ISPP ++ + QR   +E+ + +EK    Q
Sbjct:  219 ILSGFAPEFLEHAFVVDRQIVRKLQGENEEEEKGAIVTVKGGLSVISPPTEE-QQQRPEEEEKPDCDEKDKHCQ 291          
BLAST of CD859854 vs. SwissProt
Match: GLYG1_SOYBN (Glycinin G1 OS=Glycine max GN=GY1 PE=1 SV=2)

HSP 1 Score: 77.7962 bits (190), Expect = 4.468e-14
Identity = 37/70 (52.86%), Postives = 49/70 (70.00%), Query Frame = 3
Query:  225 IFSGFKRDFLEDAFNVNRHIVDRLQGRNEDEEKGAIVKVKGGLSIISPPEKQARHQRGSRQEEDEDEEKQ 434
            I SGF  +FLE AF+V++ I   LQG NE E+KGAIV VKGGLS+I PP  + + +    +EE+EDE+ Q
Sbjct:  220 ILSGFTLEFLEHAFSVDKQIAKNLQGENEGEDKGAIVTVKGGLSVIKPPTDEQQQRPQEEEEEEEDEKPQ 289          
BLAST of CD859854 vs. SwissProt
Match: GLYG2_SOYBN (Glycinin G2 OS=Glycine max GN=Gy2 PE=1 SV=2)

HSP 1 Score: 72.0182 bits (175), Expect = 2.452e-12
Identity = 35/72 (48.61%), Postives = 51/72 (70.83%), Query Frame = 3
Query:  225 IFSGFKRDFLEDAFNVNRHIVDRLQGRNEDEEKGAIVKVKGGLSIISPPEKQARHQRGSRQEEDEDEEKQPR 440
            I SGF  +FL++AF VN  IV  LQG NE+E+ GAIV VKGGL + +P  ++ +     ++E+D+DEE+QP+
Sbjct:  217 ILSGFAPEFLKEAFGVNMQIVRNLQGENEEEDSGAIVTVKGGLRVTAPAMRKPQ-----QEEDDDDEEEQPQ 283          
BLAST of CD859854 vs. SwissProt
Match: AHY3_ARAHY (Arachin Ahy-3 OS=Arachis hypogaea PE=1 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 9.317e-12
Identity = 34/64 (53.12%), Postives = 44/64 (68.75%), Query Frame = 3
Query:  225 IFSGFKRDFLEDAFNVNRHIVDRLQGRNEDEEKGAIVKVKGGLSIISPPEKQARHQRGSRQEED 416
            +FSGF  +FL   F VN  IV  L+G NE EE+GAIV VKGGLSI+ PPE +  +Q+  R ++D
Sbjct:  232 VFSGFSTEFLSHGFQVNEDIVRNLRGENEREEQGAIVTVKGGLSILVPPEWRQSYQQPGRGDKD 295          
BLAST of CD859854 vs. SwissProt
Match: LEGB_PEA (Legumin B (Fragment) OS=Pisum sativum GN=LEGB PE=2 SV=1)

HSP 1 Score: 57.3806 bits (137), Expect = 6.249e-8
Identity = 29/74 (39.19%), Postives = 46/74 (62.16%), Query Frame = 3
Query:  225 IFSGFKRDFLEDAFNVNRHIVDRLQGRNEDEEKGAIVKVKGGLSIISPPEKQARHQRGSRQEEDEDEEKQPRHQ 446
            + SGF  +FL  + N       RL  R+  +E+G IVKV+ GL IISP  ++   Q  S+++E+E+EE++ RH+
Sbjct:    4 VLSGFNVEFLAHSLNTKEDTAKRL--RSPQDERGQIVKVEDGLHIISPELQEEEEQSHSQRKEEEEEEQEQRHR 75          
BLAST of CD859854 vs. SwissProt
Match: GLYG4_SOYBN (Glycinin G4 OS=Glycine max GN=GY4 PE=1 SV=1)

HSP 1 Score: 57.3806 bits (137), Expect = 6.249e-8
Identity = 27/68 (39.71%), Postives = 44/68 (64.71%), Query Frame = 3
Query:  225 IFSGFKRDFLEDAFNVNRHIVDRLQGRNEDEEKGAIVKVKGGLSIISPPEKQARHQRGSRQEEDEDEE 428
            + SGF + FL  +FN N  I ++L+  + D+E+  IV V+GGLS+ISP  ++ + +     E+DEDE+
Sbjct:  229 VLSGFSKHFLAQSFNTNEDIAEKLE--SPDDERKQIVTVEGGLSVISPKWQEQQDEDEDEDEDDEDEQ 294          
BLAST of CD859854 vs. SwissProt
Match: GLYG5_SOYBN (Glycinin OS=Glycine max PE=1 SV=1)

HSP 1 Score: 54.299 bits (129), Expect = 5.290e-7
Identity = 29/68 (42.65%), Postives = 42/68 (61.76%), Query Frame = 3
Query:  225 IFSGFKRDFLEDAFNVNRHIVDRLQGRNEDEEKGAIVKVKGGLSIISPPEKQARHQRGSRQEEDEDEE 428
            + SGF + FL  +FN N    ++L  R+ D+E+  IV V+GGLS+ISP     + Q    ++EDEDEE
Sbjct:  228 VLSGFSKHFLAQSFNTNEDTAEKL--RSPDDERKQIVTVEGGLSVISP-----KWQEQEDEDEDEDEE 288          
BLAST of CD859854 vs. TAIR peptide
Match: AT1G04970.1 (| Symbols: | lipid-binding serum glycoprotein family protein | chr1:1411216-1413431 FORWARD LENGTH=488)

HSP 1 Score: 77.411 bits (189), Expect = 6.150e-15
Identity = 33/56 (58.93%), Postives = 47/56 (83.93%), Query Frame = -2
Query:    2 RNTKIPFLGNVYLMLSDITIYQIDVPSSVVKPGESGISIVASGVSCNLSMNWYYDY 169
            ++ KIPFLG + +++S++TIY++DV SS VK GE+G+ IVASG +CNLSMNW+Y Y
Sbjct:   63 KSMKIPFLGGIDVVVSNLTIYELDVASSYVKLGETGVVIVASGTTCNLSMNWHYSY 118          
BLAST of CD859854 vs. TAIR peptide
Match: AT1G04970.1 (| Symbols: | lipid-binding serum glycoprotein family protein | chr1:1411216-1413431 FORWARD LENGTH=488)

HSP 1 Score: 77.411 bits (189), Expect = 6.150e-15
Identity = 33/56 (58.93%), Postives = 47/56 (83.93%), Query Frame = -2
Query:    2 RNTKIPFLGNVYLMLSDITIYQIDVPSSVVKPGESGISIVASGVSCNLSMNWYYDY 169
            ++ KIPFLG + +++S++TIY++DV SS VK GE+G+ IVASG +CNLSMNW+Y Y
Sbjct:   63 KSMKIPFLGGIDVVVSNLTIYELDVASSYVKLGETGVVIVASGTTCNLSMNWHYSY 118          
BLAST of CD859854 vs. TrEMBL
Match: Q9T0P5_PEA (LegA class OS=Pisum sativum GN=legA PE=1 SV=1)

HSP 1 Score: 161.384 bits (407), Expect = 5.179e-38
Identity = 88/141 (62.41%), Postives = 89/141 (63.12%), Query Frame = 3
Query:  165 FLRYXXXXXXXXXXXXXXXXIFSGFKRDFLEDAFNVNRHIVDRLQGRNEDEEKGAIVKVKGGLSIISPPEKQARHQRGSRQEEDEDEEKQPRHQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSQKGKSRRQGD 587
            FL+Y                IFSGFKRDFLEDAFNVNRHIVDRLQGRNEDEEKGAIVKVKGGLSIISPPEKQARHQRGSRQEEDEDEEKQPRHQ                                    SQKGKSRRQGD
Sbjct:  191 FLQYQHQQGGKQEQENEGNNIFSGFKRDFLEDAFNVNRHIVDRLQGRNEDEEKGAIVKVKGGLSIISPPEKQARHQRGSRQEEDEDEEKQPRHQRGSRQEEEEDEDEERQPRHQRRRGEEEEEDKKERGGSQKGKSRRQGD 331          
BLAST of CD859854 vs. TrEMBL
Match: Q41702_VICSA (Legumin A OS=Vicia sativa PE=2 SV=1)

HSP 1 Score: 143.28 bits (360), Expect = 1.460e-32
Identity = 82/143 (57.34%), Postives = 87/143 (60.84%), Query Frame = 3
Query:  165 FLRYXXXXXXXXXXXXXXXXIFSGFKRDFLEDAFNVNRHIVDRLQGRNEDEEKGAIVKVKGGLSIISPPEKQARHQRGSRQEEDED--EEKQPRHQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSQKGKSRRQGD 587
            FLRY                IFSGFKRDFLEDAFNVNRHIVDRLQGRNEDEEKGAIVKVKGGLSII+PPE+QARH+RGSRQEEDED  EE+QP H                                     SQKG+SRRQGD
Sbjct:  191 FLRYQHQQGGKQEQDNDGNNIFSGFKRDFLEDAFNVNRHIVDRLQGRNEDEEKGAIVKVKGGLSIIAPPERQARHERGSRQEEDEDEKEERQPSHH---------------------KSRRDEDEDDKEKRHSQKGQSRRQGD 312          
BLAST of CD859854 vs. TrEMBL
Match: Q99304_VICFA (Legumin A2 primary translation product OS=Vicia faba var. minor GN=LeA2 PE=2 SV=1)

HSP 1 Score: 137.117 bits (344), Expect = 1.046e-30
Identity = 80/145 (55.17%), Postives = 84/145 (57.93%), Query Frame = 3
Query:  165 FLRYXXXXXXXXXXXXXXXXIFSGFKRDFLEDAFNVNRHIVDRLQGRNEDEEKGAIVKVKGGLSIISPPEKQARHQRGSRQEEDEDE----EKQPRHQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSQKGKSRRQGD 587
            FLRY                IFSGFKRDFLEDA NVNRHIVDRLQGRNEDEEKGAIVKVKGGLSII+PPE+QARH RGSRQEEDEDE    E+QP H                                     SQKG+SRR GD
Sbjct:  191 FLRYQHQQGGKEEQDNDGNNIFSGFKRDFLEDALNVNRHIVDRLQGRNEDEEKGAIVKVKGGLSIITPPERQARHPRGSRQEEDEDEDEKEERQPSHHKSRRGEDEDDKEKRH---------------------SQKGESRRHGD 314          
BLAST of CD859854 vs. TrEMBL
Match: Q03971_VICFA (N-terminal incomplete legumin A1 pre-pro-polypeptide (Fragment) OS=Vicia faba var. minor GN=LeA1 PE=2 SV=1)

HSP 1 Score: 126.331 bits (316), Expect = 1.846e-27
Identity = 77/147 (52.38%), Postives = 82/147 (55.78%), Query Frame = 3
Query:  165 FLRYXXXXXXXXXXXXXXXXIFSGFKRDFLEDAFNVNRHIVDRLQGRNEDEEKGAIVKVKGGLSIISPPEKQARHQRGSRQEEDEDE------EKQPRHQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSQKGKSRRQGD 587
            FLRY                IFSGF RDFLEDAFNVNRHIVDRLQGRNE  E+GAIVKVKGGLSII+PPE+QARH RGSRQEEDEDE      E+QP H                                     SQKG+SRR GD
Sbjct:  184 FLRYQHRQGVKEEQDNDGNNIFSGFNRDFLEDAFNVNRHIVDRLQGRNE--ERGAIVKVKGGLSIITPPERQARHPRGSRQEEDEDEDEDEKEERQPSHHKSRRGEDEDDKEKRH---------------------SQKGESRRHGD 307          
BLAST of CD859854 vs. TrEMBL
Match: Q41676_VICNA (Legumin A OS=Vicia narbonensis PE=2 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 1.563e-26
Identity = 76/143 (53.15%), Postives = 81/143 (56.64%), Query Frame = 3
Query:  165 FLRYXXXXXXXXXXXXXXXXIFSGFKRDFLEDAFNVNRHIVDRLQGRNEDEEKGAIVKVKGGLSIISPPEKQARHQRGSRQEEDEDE--EKQPRHQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSQKGKSRRQGD 587
            FLRY                IFSGFKRDFLEDA NVNRHIVDRLQGRNEDEEKGAIVKVKGGLSII+PPE+Q    RGSRQEEDEDE  E+QP  +                                    SQKG+SRR GD
Sbjct:  191 FLRYQREQGGKQEQENDGNNIFSGFKRDFLEDALNVNRHIVDRLQGRNEDEEKGAIVKVKGGLSIITPPERQ----RGSRQEEDEDEKEERQPSRRRDE---------------------------------SQKGESRRHGD 296          
BLAST of CD859854 vs. TrEMBL
Match: B5U8K6_LOTJA (Legumin storage protein 5 OS=Lotus japonicus GN=llp5 PE=2 SV=1)

HSP 1 Score: 104.375 bits (259), Expect = 7.514e-21
Identity = 50/94 (53.19%), Postives = 70/94 (74.47%), Query Frame = 3
Query:  165 FLRYXXXXXXXXXXXXXXXXIFSGFKRDFLEDAFNVNRHIVDRLQGRNEDEEKGAIVKVKGGLSIISPPEKQARHQRGSRQEEDEDEEKQPRHQ 446
            FL+Y                IFSGF  +FLEDA N++R+IV +LQGR+E+++KGAIV+VKGGLS+I+PPE+Q+ H+RGS +EEDE+E++  RHQ
Sbjct:  190 FLQYQRQEVRGREEENQGGNIFSGFGGEFLEDALNIDRNIVHKLQGRDEEQDKGAIVRVKGGLSVITPPERQS-HRRGSEEEEDEEEDRPSRHQ 282          
BLAST of CD859854 vs. TrEMBL
Match: C6TGG8_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 7.775e-18
Identity = 42/56 (75.00%), Postives = 50/56 (89.29%), Query Frame = -2
Query:    2 RNTKIPFLGNVYLMLSDITIYQIDVPSSVVKPGESGISIVASGVSCNLSMNWYYDY 169
            +  KIP +GNVY++LS+ITIY IDVPSS VKPGE+GISI+ASGV+CNLSMNWYY Y
Sbjct:   63 KTAKIPVVGNVYMVLSNITIYHIDVPSSHVKPGETGISIIASGVTCNLSMNWYYSY 118          
BLAST of CD859854 vs. TrEMBL
Match: D7TEG9_VITVI (Whole genome shotgun sequence of line PN40024, scaffold_59.assembly12x (Fragment) OS=Vitis vinifera GN=VIT_00030539001 PE=4 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 3.380e-13
Identity = 33/57 (57.89%), Postives = 46/57 (80.70%), Query Frame = -2
Query:    2 RRNTKIPFLGNVYLMLSDITIYQIDVPSSVVKPGESGISIVASGVSCNLSMNWYYDY 172
            +++ KIPFLG V +  S+ITIY IDV SS + PG++G++I+ASG +CNLSMNW+Y Y
Sbjct:   63 KKSVKIPFLGRVDIAFSNITIYHIDVSSSNIAPGDTGVAIIASGTTCNLSMNWHYSY 119          
BLAST of CD859854 vs. TrEMBL
Match: D7KE97_ARALY (Putative uncharacterized protein OS=Arabidopsis lyrata subsp. lyrata GN=ARALYDRAFT_887673 PE=4 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 7.531e-13
Identity = 33/56 (58.93%), Postives = 47/56 (83.93%), Query Frame = -2
Query:    2 RNTKIPFLGNVYLMLSDITIYQIDVPSSVVKPGESGISIVASGVSCNLSMNWYYDY 169
            ++ KIPFLG + +++S++TIY++DV SS VK GE+G+ IVASG +CNLSMNW+Y Y
Sbjct:   63 KSVKIPFLGGIDVVVSNLTIYELDVASSYVKLGETGVVIVASGTTCNLSMNWHYSY 118          
BLAST of CD859854 vs. TrEMBL
Match: C7EA92_SOYBN (Mutant glycinin subunit A1aB1b OS=Glycine max GN=Gy1 PE=2 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 7.531e-13
Identity = 37/70 (52.86%), Postives = 49/70 (70.00%), Query Frame = 3
Query:  225 IFSGFKRDFLEDAFNVNRHIVDRLQGRNEDEEKGAIVKVKGGLSIISPPEKQARHQRGSRQEEDEDEEKQ 434
            I SGF  +FLE AF+V++ I   LQG NE E+KGAIV VKGGLS+I PP  + + +    +EE+EDE+ Q
Sbjct:  220 ILSGFTLEFLEHAFSVDKQIAKNLQGENEGEDKGAIVTVKGGLSVIKPPTDEQQQRPQEEEEEEEDEKPQ 289          
BLAST of CD859854 vs. Lotus protein
Match: chr1.CM0295.240.r2.d (+ phase: 0 )

HSP 1 Score: 104.375 bits (259), Expect = 2.780e-23
Identity = 50/94 (53.19%), Postives = 70/94 (74.47%), Query Frame = 3
Query:  165 FLRYXXXXXXXXXXXXXXXXIFSGFKRDFLEDAFNVNRHIVDRLQGRNEDEEKGAIVKVKGGLSIISPPEKQARHQRGSRQEEDEDEEKQPRHQ 446
            FL+Y                IFSGF  +FLEDA N++R+IV +LQGR+E+++KGAIV+VKGGLS+I+PPE+Q+ H+RGS +EEDE+E++  RHQ
Sbjct:  190 FLQYQRQEVRGREEENQGGNIFSGFGGEFLEDALNIDRNIVHKLQGRDEEQDKGAIVRVKGGLSVITPPERQS-HRRGSEEEEDEEEDRPSRHQ 282          
BLAST of CD859854 vs. Lotus protein
Match: chr1.CM0295.280.r2.d (- phase: 0 )

HSP 1 Score: 99.7525 bits (247), Expect = 6.847e-22
Identity = 48/94 (51.06%), Postives = 68/94 (72.34%), Query Frame = 3
Query:  165 FLRYXXXXXXXXXXXXXXXXIFSGFKRDFLEDAFNVNRHIVDRLQGRNEDEEKGAIVKVKGGLSIISPPEKQARHQRGSRQEEDEDEEKQPRHQ 446
            FL+Y                IFSGF  +FLE A N++R IV +LQG++E+++KGAIV+VKGGLS+I+PPE+Q+ H+RGS +EEDE+E++  RHQ
Sbjct:  189 FLQYQRQEMRGKEEENQGGNIFSGFGGEFLEHALNIDRDIVHKLQGKDEEQDKGAIVRVKGGLSVITPPERQS-HRRGSEEEEDEEEDRPSRHQ 281          
BLAST of CD859854 vs. Lotus protein
Match: chr2.CM1285.90.r2.a (+ phase: 0 )

HSP 1 Score: 95.9005 bits (237), Expect = 9.887e-21
Identity = 43/56 (76.79%), Postives = 52/56 (92.86%), Query Frame = -2
Query:    2 RNTKIPFLGNVYLMLSDITIYQIDVPSSVVKPGESGISIVASGVSCNLSMNWYYDY 169
            ++ KIP +GNVY+M+S+ITIY+IDVPSS VKPGE+GISIVASGV+CNLSMNWYY Y
Sbjct:   63 KSRKIPVVGNVYMMVSNITIYEIDVPSSHVKPGETGISIVASGVTCNLSMNWYYSY 118          
BLAST of CD859854 vs. Lotus protein
Match: chr6.CM1514.340.r2.m (+ phase: 0 )

HSP 1 Score: 59.3066 bits (142), Expect = 1.026e-9
Identity = 28/53 (52.83%), Postives = 37/53 (69.81%), Query Frame = -2
Query:    8 NTKIPFLGNVYLMLSDITIYQIDVPSSVVKPGESGISIVASGVSCNLSMNWYY 166
            + K+P +GN  ++LSDITI  I + SS VK GESGI +V SG + +LSM W Y
Sbjct:   64 SAKVPLVGNAKVVLSDITIKDIQINSSSVKTGESGIVLVISGATADLSMKWRY 116          
BLAST of CD859854 vs. Lotus protein
Match: chr2.CM0667.100.r2.a (- phase: 0 )

HSP 1 Score: 53.5286 bits (127), Expect = 5.627e-8
Identity = 24/54 (44.44%), Postives = 35/54 (64.81%), Query Frame = -2
Query:    8 RNTKIPFLGNVYLMLSDITIYQIDVPSSVVKPGESGISIVASGVSCNLSMNWYY 169
            +  K+P +G   ++LSDITI  I V SS V  G++GI +V SG + NL++ W Y
Sbjct:   63 KTVKVPLVGKANVILSDITINDIQVSSSSVNTGDTGIVLVISGATANLTLKWRY 116          
BLAST of CD859854 vs. Lotus protein
Match: chr2.CM0667.70.r2.a (- phase: 0 )

HSP 1 Score: 53.5286 bits (127), Expect = 5.627e-8
Identity = 24/54 (44.44%), Postives = 35/54 (64.81%), Query Frame = -2
Query:    8 RNTKIPFLGNVYLMLSDITIYQIDVPSSVVKPGESGISIVASGVSCNLSMNWYY 169
            +  K+P +G   ++LSDITI  I V SS V  G++GI +V SG + NL++ W Y
Sbjct:   63 KTVKVPLVGKANVILSDITIKDIQVSSSSVNTGDTGIFLVISGATANLTLKWRY 116          
BLAST of CD859854 vs. Lotus protein
Match: chr1.CM0295.230.r2.m (- phase: 0 )

HSP 1 Score: 53.1434 bits (126), Expect = 7.349e-8
Identity = 29/74 (39.19%), Postives = 42/74 (56.76%), Query Frame = 3
Query:  225 IFSGFKRDFLEDAFNVNRHIVDRLQGRNEDEEKGAIVKVKGGLSIISPPEKQARHQRGSRQEEDEDEEKQPRHQ 446
            +F GF   FL     V   ++ +LQ   +D +K  I+ VKGGLSII PP +Q   +   R EE+EDE ++  H+
Sbjct:  229 MFGGFDSAFLSRVLKVKEDLISKLQSPKDDRKK-QIIHVKGGLSIIRPPLEQEIRETEQR-EEEEDEPREGEHR 300          
BLAST of CD859854 vs. Soybean peptides
Match: Glyma14g05590.1|PACid:16294467 ()

HSP 1 Score: 94.3597 bits (233), Expect = 7.312e-20
Identity = 42/56 (75.00%), Postives = 50/56 (89.29%), Query Frame = -2
Query:    2 RNTKIPFLGNVYLMLSDITIYQIDVPSSVVKPGESGISIVASGVSCNLSMNWYYDY 169
            +  KIP +GNVY++LS+ITIY IDVPSS VKPGE+GISI+ASGV+CNLSMNWYY Y
Sbjct:   63 KTAKIPVVGNVYMVLSNITIYHIDVPSSHVKPGETGISIIASGVTCNLSMNWYYSY 118          
BLAST of CD859854 vs. Soybean peptides
Match: Glyma02g43390.1|PACid:16250017 ()

HSP 1 Score: 87.0409 bits (214), Expect = 1.167e-17
Identity = 38/56 (67.86%), Postives = 49/56 (87.50%), Query Frame = -2
Query:    2 RNTKIPFLGNVYLMLSDITIYQIDVPSSVVKPGESGISIVASGVSCNLSMNWYYDY 169
            +  KIP +G+VY++LS+I+ Y IDVPSS VKPGE+GISI+ASGV+CNLS+NWYY Y
Sbjct:   63 KTVKIPVVGSVYMVLSNISSYHIDVPSSHVKPGETGISIIASGVTCNLSINWYYSY 118          
BLAST of CD859854 vs. Soybean peptides
Match: Glyma19g34780.1|PACid:16313770 ()

HSP 1 Score: 77.7962 bits (190), Expect = 7.082e-15
Identity = 41/74 (55.41%), Postives = 53/74 (71.62%), Query Frame = 3
Query:  225 IFSGFKRDFLEDAFNVNRHIVDRLQGRNEDEEKGAIVKVKGGLSIISPPEKQARHQRGSRQEEDEDEEKQPRHQ 446
            I SGF  +FLE AF V+R IV +LQG NE+EEKGAIV VKGGLS+ISPP ++ + QR   +E+ + +EK    Q
Sbjct:  219 ILSGFAPEFLEHAFVVDRQIVRKLQGENEEEEKGAIVTVKGGLSVISPPTEE-QQQRPEEEEKPDCDEKDKHCQ 291          
BLAST of CD859854 vs. Soybean peptides
Match: Glyma03g32030.1|PACid:16253019 ()

HSP 1 Score: 77.7962 bits (190), Expect = 7.082e-15
Identity = 37/70 (52.86%), Postives = 49/70 (70.00%), Query Frame = 3
Query:  225 IFSGFKRDFLEDAFNVNRHIVDRLQGRNEDEEKGAIVKVKGGLSIISPPEKQARHQRGSRQEEDEDEEKQ 434
            I SGF  +FLE AF+V++ I   LQG NE E+KGAIV VKGGLS+I PP  + + +    +EE+EDE+ Q
Sbjct:  220 ILSGFTLEFLEHAFSVDKQIAKNLQGENEGEDKGAIVTVKGGLSVIKPPTDEQQQRPQEEEEEEEDEKPQ 289          
BLAST of CD859854 vs. Soybean peptides
Match: Glyma03g32020.2|PACid:16253018 ()

HSP 1 Score: 72.0182 bits (175), Expect = 3.886e-13
Identity = 35/72 (48.61%), Postives = 51/72 (70.83%), Query Frame = 3
Query:  225 IFSGFKRDFLEDAFNVNRHIVDRLQGRNEDEEKGAIVKVKGGLSIISPPEKQARHQRGSRQEEDEDEEKQPR 440
            I SGF  +FL++AF VN  IV  LQG NE+E+ GAIV VKGGL + +P  ++ +     ++E+D+DEE+QP+
Sbjct:  217 ILSGFAPEFLKEAFGVNMQIVRNLQGENEEEDSGAIVTVKGGLRVTAPAMRKPQ-----QEEDDDDEEEQPQ 283          
BLAST of CD859854 vs. Soybean peptides
Match: Glyma03g32020.1|PACid:16253017 ()

HSP 1 Score: 72.0182 bits (175), Expect = 3.886e-13
Identity = 35/72 (48.61%), Postives = 51/72 (70.83%), Query Frame = 3
Query:  225 IFSGFKRDFLEDAFNVNRHIVDRLQGRNEDEEKGAIVKVKGGLSIISPPEKQARHQRGSRQEEDEDEEKQPR 440
            I SGF  +FL++AF VN  IV  LQG NE+E+ GAIV VKGGL + +P  ++ +     ++E+D+DEE+QP+
Sbjct:  217 ILSGFAPEFLKEAFGVNMQIVRNLQGENEEEDSGAIVTVKGGLRVTAPAMRKPQ-----QEEDDDDEEEQPQ 283          
BLAST of CD859854 vs. Soybean peptides
Match: Glyma18g10070.1|PACid:16308453 ()

HSP 1 Score: 58.5362 bits (140), Expect = 4.446e-9
Identity = 27/53 (50.94%), Postives = 37/53 (69.81%), Query Frame = -2
Query:    8 NTKIPFLGNVYLMLSDITIYQIDVPSSVVKPGESGISIVASGVSCNLSMNWYY 166
            + ++P +GN  ++LSDITI  ++V SS VK GESGI +V SG   N+SM W Y
Sbjct:   64 SAQVPLVGNAKVVLSDITIKDVEVNSSSVKTGESGIVLVISGAIANMSMRWRY 116          
BLAST of CD859854 vs. Soybean peptides
Match: Glyma10g04280.1|PACid:16278535 ()

HSP 1 Score: 58.5362 bits (140), Expect = 4.446e-9
Identity = 28/68 (41.18%), Postives = 44/68 (64.71%), Query Frame = 3
Query:  225 IFSGFKRDFLEDAFNVNRHIVDRLQGRNEDEEKGAIVKVKGGLSIISPPEKQARHQRGSRQEEDEDEE 428
            + SGF + FL  +FN N  I ++LQ  + D+E+  IV V+GGLS+ISP  ++ + +     E+DEDE+
Sbjct:  229 VLSGFSKHFLAQSFNTNEDIAEKLQ--SPDDERKQIVTVEGGLSVISPKWQEQQDEDEDEDEDDEDEQ 294          
BLAST of CD859854 vs. Soybean peptides
Match: Glyma02g46500.1|PACid:16250407 ()

HSP 1 Score: 55.8398 bits (133), Expect = 2.882e-8
Identity = 25/54 (46.30%), Postives = 37/54 (68.52%), Query Frame = -2
Query:    8 RNTKIPFLGNVYLMLSDITIYQIDVPSSVVKPGESGISIVASGVSCNLSMNWYY 169
            +  ++P +G   ++LSDITI  I V SS V  GE+GI++V SG + +LS+NW Y
Sbjct:   62 KTVQVPLVGKAKVVLSDITINHIQVNSSSVNTGETGIALVVSGATADLSLNWRY 115          
BLAST of CD859854 vs. Soybean peptides
Match: Glyma13g18450.1|PACid:16290721 ()

HSP 1 Score: 54.299 bits (129), Expect = 8.385e-8
Identity = 29/68 (42.65%), Postives = 42/68 (61.76%), Query Frame = 3
Query:  225 IFSGFKRDFLEDAFNVNRHIVDRLQGRNEDEEKGAIVKVKGGLSIISPPEKQARHQRGSRQEEDEDEE 428
            + SGF + FL  +FN N    ++L  R+ D+E+  IV V+GGLS+ISP     + Q    ++EDEDEE
Sbjct:  200 VLSGFSKHFLAQSFNTNEDTAEKL--RSPDDERKQIVTVEGGLSVISP-----KWQEQEDEDEDEDEE 260          
BLAST of CD859854 vs. SwissProt
Match: LEGA_PEA (Legumin A OS=Pisum sativum GN=LEGA PE=1 SV=1)

HSP 1 Score: 160.229 bits (404), Expect = 6.970e-39
Identity = 87/141 (61.70%), Postives = 89/141 (63.12%), Query Frame = 3
Query:  165 FLRYXXXXXXXXXXXXXXXXIFSGFKRDFLEDAFNVNRHIVDRLQGRNEDEEKGAIVKVKGGLSIISPPEKQARHQRGSRQEEDEDEEKQPRHQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSQKGKSRRQGD 587
            FL+Y                IFSGFKRD+LEDAFNVNRHIVDRLQGRNEDEEKGAIVKVKGGLSIISPPEKQARHQRGSRQEEDEDEEKQPRHQ                                    SQKGKSRRQGD
Sbjct:  191 FLQYQHQQGGKQEQENEGNNIFSGFKRDYLEDAFNVNRHIVDRLQGRNEDEEKGAIVKVKGGLSIISPPEKQARHQRGSRQEEDEDEEKQPRHQRGSRQEEEEDEDEERQPRHQRRRGEEEEEDKKERGGSQKGKSRRQGD 331          
BLAST of CD859854 vs. SwissProt
Match: LEGA2_PEA (Legumin A2 OS=Pisum sativum GN=LEGA2 PE=3 SV=1)

HSP 1 Score: 156.762 bits (395), Expect = 7.706e-38
Identity = 88/143 (61.54%), Postives = 89/143 (62.24%), Query Frame = 3
Query:  165 FLRYXXXXXXXXXXXXXXXXIFSGFKRDFLEDAFNVNRHIVDRLQGRNEDEEKGAIVKVKGGLSIISPPEKQARHQRGSRQE--EDEDEEKQPRHQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSQKGKSRRQGD 587
            FLRY                IFSGFKRDFLEDAFNVNRHIVDRLQGRNEDEEKGAIVKVKGGLSIISPPEKQARHQRGSRQE  EDEDEE+QPRHQ                                    SQKGKSRRQGD
Sbjct:  192 FLRYQHQQGGKQEQENEGNNIFSGFKRDFLEDAFNVNRHIVDRLQGRNEDEEKGAIVKVKGGLSIISPPEKQARHQRGSRQEEDEDEDEERQPRHQRGSRQEEEEDEDEERQPRHQRRRGEEEEEDKKERRGSQKGKSRRQGD 334          
BLAST of CD859854 vs. SwissProt
Match: LEG_CICAR (Legumin OS=Cicer arietinum GN=leg3 PE=1 SV=1)

HSP 1 Score: 120.168 bits (300), Expect = 7.993e-27
Identity = 60/75 (80.00%), Postives = 67/75 (89.33%), Query Frame = 3
Query:  225 IFSGFKRDFLEDAFNVNRHIVDRLQGRNEDEEKGAIVKVKGGLSIISPPEKQARHQRGSRQEEDEDE-EKQPRHQ 446
            IFSGFKRDFLEDA NVNR IV++LQGRNEDEEKGAIVKVKGGLSI +PPEK+ R +RGSRQEEDEDE EK+  H+
Sbjct:  209 IFSGFKRDFLEDALNVNRRIVNKLQGRNEDEEKGAIVKVKGGLSITTPPEKEPRQKRGSRQEEDEDEDEKRQPHR 283          
BLAST of CD859854 vs. SwissProt
Match: GLYG3_SOYBN (Glycinin G3 OS=Glycine max GN=GY3 PE=3 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 4.549e-14
Identity = 41/74 (55.41%), Postives = 53/74 (71.62%), Query Frame = 3
Query:  225 IFSGFKRDFLEDAFNVNRHIVDRLQGRNEDEEKGAIVKVKGGLSIISPPEKQARHQRGSRQEEDEDEEKQPRHQ 446
            I SGF  +FLE AF V+R IV +LQG NE+EEKGAIV VKGGLS+ISPP ++ + QR   +E+ + +EK    Q
Sbjct:  219 ILSGFAPEFLEHAFVVDRQIVRKLQGENEEEEKGAIVTVKGGLSVISPPTEE-QQQRPEEEEKPDCDEKDKHCQ 291          
BLAST of CD859854 vs. SwissProt
Match: GLYG1_SOYBN (Glycinin G1 OS=Glycine max GN=GY1 PE=1 SV=2)

HSP 1 Score: 77.7962 bits (190), Expect = 4.549e-14
Identity = 37/70 (52.86%), Postives = 49/70 (70.00%), Query Frame = 3
Query:  225 IFSGFKRDFLEDAFNVNRHIVDRLQGRNEDEEKGAIVKVKGGLSIISPPEKQARHQRGSRQEEDEDEEKQ 434
            I SGF  +FLE AF+V++ I   LQG NE E+KGAIV VKGGLS+I PP  + + +    +EE+EDE+ Q
Sbjct:  220 ILSGFTLEFLEHAFSVDKQIAKNLQGENEGEDKGAIVTVKGGLSVIKPPTDEQQQRPQEEEEEEEDEKPQ 289          
BLAST of CD859854 vs. SwissProt
Match: GLYG2_SOYBN (Glycinin G2 OS=Glycine max GN=Gy2 PE=1 SV=2)

HSP 1 Score: 72.0182 bits (175), Expect = 2.496e-12
Identity = 35/72 (48.61%), Postives = 51/72 (70.83%), Query Frame = 3
Query:  225 IFSGFKRDFLEDAFNVNRHIVDRLQGRNEDEEKGAIVKVKGGLSIISPPEKQARHQRGSRQEEDEDEEKQPR 440
            I SGF  +FL++AF VN  IV  LQG NE+E+ GAIV VKGGL + +P  ++ +     ++E+D+DEE+QP+
Sbjct:  217 ILSGFAPEFLKEAFGVNMQIVRNLQGENEEEDSGAIVTVKGGLRVTAPAMRKPQ-----QEEDDDDEEEQPQ 283          
BLAST of CD859854 vs. SwissProt
Match: AHY3_ARAHY (Arachin Ahy-3 OS=Arachis hypogaea PE=1 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 9.486e-12
Identity = 34/64 (53.12%), Postives = 44/64 (68.75%), Query Frame = 3
Query:  225 IFSGFKRDFLEDAFNVNRHIVDRLQGRNEDEEKGAIVKVKGGLSIISPPEKQARHQRGSRQEED 416
            +FSGF  +FL   F VN  IV  L+G NE EE+GAIV VKGGLSI+ PPE +  +Q+  R ++D
Sbjct:  232 VFSGFSTEFLSHGFQVNEDIVRNLRGENEREEQGAIVTVKGGLSILVPPEWRQSYQQPGRGDKD 295          
BLAST of CD859854 vs. SwissProt
Match: LEGB_PEA (Legumin B (Fragment) OS=Pisum sativum GN=LEGB PE=2 SV=1)

HSP 1 Score: 57.3806 bits (137), Expect = 6.363e-8
Identity = 29/74 (39.19%), Postives = 46/74 (62.16%), Query Frame = 3
Query:  225 IFSGFKRDFLEDAFNVNRHIVDRLQGRNEDEEKGAIVKVKGGLSIISPPEKQARHQRGSRQEEDEDEEKQPRHQ 446
            + SGF  +FL  + N       RL  R+  +E+G IVKV+ GL IISP  ++   Q  S+++E+E+EE++ RH+
Sbjct:    4 VLSGFNVEFLAHSLNTKEDTAKRL--RSPQDERGQIVKVEDGLHIISPELQEEEEQSHSQRKEEEEEEQEQRHR 75          
BLAST of CD859854 vs. SwissProt
Match: GLYG4_SOYBN (Glycinin G4 OS=Glycine max GN=GY4 PE=1 SV=1)

HSP 1 Score: 57.3806 bits (137), Expect = 6.363e-8
Identity = 27/68 (39.71%), Postives = 44/68 (64.71%), Query Frame = 3
Query:  225 IFSGFKRDFLEDAFNVNRHIVDRLQGRNEDEEKGAIVKVKGGLSIISPPEKQARHQRGSRQEEDEDEE 428
            + SGF + FL  +FN N  I ++L+  + D+E+  IV V+GGLS+ISP  ++ + +     E+DEDE+
Sbjct:  229 VLSGFSKHFLAQSFNTNEDIAEKLE--SPDDERKQIVTVEGGLSVISPKWQEQQDEDEDEDEDDEDEQ 294          
BLAST of CD859854 vs. SwissProt
Match: GLYG5_SOYBN (Glycinin OS=Glycine max PE=1 SV=1)

HSP 1 Score: 54.299 bits (129), Expect = 5.387e-7
Identity = 29/68 (42.65%), Postives = 42/68 (61.76%), Query Frame = 3
Query:  225 IFSGFKRDFLEDAFNVNRHIVDRLQGRNEDEEKGAIVKVKGGLSIISPPEKQARHQRGSRQEEDEDEE 428
            + SGF + FL  +FN N    ++L  R+ D+E+  IV V+GGLS+ISP     + Q    ++EDEDEE
Sbjct:  228 VLSGFSKHFLAQSFNTNEDTAEKL--RSPDDERKQIVTVEGGLSVISP-----KWQEQEDEDEDEDEE 288          
BLAST of CD859854 vs. Medicago proteins
Match: IMGA|Medtr5g084690.1 (Unknown Protein (AHRD V1); contains Interpro domain(s) IPR001124 Lipid-binding serum glycoprotein, C-terminal chr05_pseudomolecule_IMGAG_V3.5 35526949-35532016 E EGN_Mt100125 20100825)

HSP 1 Score: 83.9593 bits (206), Expect = 5.715e-17
Identity = 37/56 (66.07%), Postives = 49/56 (87.50%), Query Frame = -2
Query:    2 RNTKIPFLGNVYLMLSDITIYQIDVPSSVVKPGESGISIVASGVSCNLSMNWYYDY 169
            + T+IP LG+VY +LS+ITIY+IDV SS VKPGE+GI I+ASGVSCN+S++W Y+Y
Sbjct:   66 KGTRIPMLGSVYFVLSNITIYEIDVDSSNVKPGENGIEILASGVSCNMSLDWSYEY 121          
BLAST of CD859854 vs. Medicago proteins
Match: IMGA|Medtr5g093980.2 (Unknown Protein (AHRD V1); contains Interpro domain(s) IPR017942 Lipid-binding serum glycoprotein, N-terminal chr05_pseudomolecule_IMGAG_V3.5 40015029-40012591 E EGN_Mt100125 20100825)

HSP 1 Score: 58.5362 bits (140), Expect = 2.571e-9
Identity = 24/54 (44.44%), Postives = 40/54 (74.07%), Query Frame = -2
Query:    8 RNTKIPFLGNVYLMLSDITIYQIDVPSSVVKPGESGISIVASGVSCNLSMNWYY 169
            ++ ++P +G  +++LS+ITI  I V SS V+ G++GI++V SG + NLS+NW Y
Sbjct:   61 KSVQVPLVGKAHVILSEITIKNIQVSSSYVETGDTGINVVVSGATANLSLNWRY 114          
BLAST of CD859854 vs. Medicago proteins
Match: IMGA|Medtr5g093980.1 (Bactericidal permeability-increasing protein (Fragment) (AHRD V1 *-*- Q28739); contains Interpro domain(s) IPR001124 Lipid-binding serum glycoprotein, C-terminal chr05_pseudomolecule_IMGAG_V3.5 40015029-40010268 E EGN_Mt100125 20100825)

HSP 1 Score: 58.5362 bits (140), Expect = 2.571e-9
Identity = 24/54 (44.44%), Postives = 40/54 (74.07%), Query Frame = -2
Query:    8 RNTKIPFLGNVYLMLSDITIYQIDVPSSVVKPGESGISIVASGVSCNLSMNWYY 169
            ++ ++P +G  +++LS+ITI  I V SS V+ G++GI++V SG + NLS+NW Y
Sbjct:   61 KSVQVPLVGKAHVILSEITIKNIQVSSSYVETGDTGINVVVSGATANLSLNWRY 114          
BLAST of CD859854 vs. Medicago proteins
Match: IMGA|Medtr1g072610.3 (Legumin K (Fragment) (AHRD V1 *-*- P05693); contains Interpro domain(s) IPR014710 RmlC-like jelly roll fold chr01_pseudomolecule_IMGAG_V3.5 18236944-18234714 F EGN_Mt100125 20100825)

HSP 1 Score: 57.3806 bits (137), Expect = 5.728e-9
Identity = 30/73 (41.10%), Postives = 45/73 (61.64%), Query Frame = 3
Query:  225 IFSGFKRDFLEDAFNVNRHIVDRLQGRNEDEEKGAIVKVKGGLSIISPPEKQARHQRGSRQEEDEDEEKQPRH 443
            + SGF  +FL  A N ++    RLQ   +  ++  IV+V+GGLSIIS PE Q   +   R  E+E++E++PRH
Sbjct:  237 VLSGFSSEFLAQALNTDQDTAKRLQSPRD--QRSQIVRVEGGLSIIS-PEWQQEDEEYERSHEEEEDERRPRH 306          
BLAST of CD859854 vs. Medicago proteins
Match: IMGA|Medtr1g072630.2 (Legumin B (Fragment) (AHRD V1 ***- P14594); contains Interpro domain(s) IPR014710 RmlC-like jelly roll fold chr01_pseudomolecule_IMGAG_V3.5 18241766-18234714 E EGN_Mt100125 20100825)

HSP 1 Score: 57.3806 bits (137), Expect = 5.728e-9
Identity = 30/73 (41.10%), Postives = 45/73 (61.64%), Query Frame = 3
Query:  225 IFSGFKRDFLEDAFNVNRHIVDRLQGRNEDEEKGAIVKVKGGLSIISPPEKQARHQRGSRQEEDEDEEKQPRH 443
            + SGF  +FL  A N ++    RLQ   +  ++  IV+V+GGLSIIS PE Q   +   R  E+E++E++PRH
Sbjct:  238 VLSGFSSEFLAQALNTDQDTAKRLQSPRD--QRSQIVRVEGGLSIIS-PEWQQEDEEYERSHEEEEDERRPRH 307          
BLAST of CD859854 vs. Medicago proteins
Match: IMGA|Medtr1g072610.2 (Legumin B (Fragment) (AHRD V1 ***- P14594); contains Interpro domain(s) IPR014710 RmlC-like jelly roll fold chr01_pseudomolecule_IMGAG_V3.5 18236944-18228841 F EGN_Mt100125 20100825)

HSP 1 Score: 57.3806 bits (137), Expect = 5.728e-9
Identity = 30/73 (41.10%), Postives = 45/73 (61.64%), Query Frame = 3
Query:  225 IFSGFKRDFLEDAFNVNRHIVDRLQGRNEDEEKGAIVKVKGGLSIISPPEKQARHQRGSRQEEDEDEEKQPRH 443
            + SGF  +FL  A N ++    RLQ   +  ++  IV+V+GGLSIIS PE Q   +   R  E+E++E++PRH
Sbjct:  237 VLSGFSSEFLAQALNTDQDTAKRLQSPRD--QRSQIVRVEGGLSIIS-PEWQQEDEEYERSHEEEEDERRPRH 306          
BLAST of CD859854 vs. Medicago proteins
Match: IMGA|Medtr1g072610.1 (Legumin B (Fragment) (AHRD V1 ***- P14594); contains Interpro domain(s) IPR014710 RmlC-like jelly roll fold chr01_pseudomolecule_IMGAG_V3.5 18236944-18234714 F EGN_Mt100125 20100825)

HSP 1 Score: 57.3806 bits (137), Expect = 5.728e-9
Identity = 30/73 (41.10%), Postives = 45/73 (61.64%), Query Frame = 3
Query:  225 IFSGFKRDFLEDAFNVNRHIVDRLQGRNEDEEKGAIVKVKGGLSIISPPEKQARHQRGSRQEEDEDEEKQPRH 443
            + SGF  +FL  A N ++    RLQ   +  ++  IV+V+GGLSIIS PE Q   +   R  E+E++E++PRH
Sbjct:  237 VLSGFSSEFLAQALNTDQDTAKRLQSPRD--QRSQIVRVEGGLSIIS-PEWQQEDEEYERSHEEEEDERRPRH 306          
BLAST of CD859854 vs. Medicago proteins
Match: IMGA|Medtr1g072600.1 (Legumin B (Fragment) (AHRD V1 *-*- P14594); contains Interpro domain(s) IPR014710 RmlC-like jelly roll fold chr01_pseudomolecule_IMGAG_V3.5 18231234-18228841 E EGN_Mt100125 20100825)

HSP 1 Score: 57.3806 bits (137), Expect = 5.728e-9
Identity = 30/73 (41.10%), Postives = 45/73 (61.64%), Query Frame = 3
Query:  225 IFSGFKRDFLEDAFNVNRHIVDRLQGRNEDEEKGAIVKVKGGLSIISPPEKQARHQRGSRQEEDEDEEKQPRH 443
            + SGF  +FL  A N ++    RLQ   +  ++  IV+V+GGLSIIS PE Q   +   R  E+E++E++PRH
Sbjct:  238 VLSGFSSEFLAQALNTDQDTAKRLQSPRD--QRSQIVRVEGGLSIIS-PEWQQEDEEYERSHEEEEDERRPRH 307          
BLAST of CD859854 vs. Medicago proteins
Match: IMGA|Medtr1g072630.3 (Legumin B (AHRD V1 *-*- Q41703_VICSA); contains Interpro domain(s) IPR014710 RmlC-like jelly roll fold chr01_pseudomolecule_IMGAG_V3.5 18241766-18239526 E EGN_Mt100125 20100825)

HSP 1 Score: 52.373 bits (124), Expect = 1.843e-7
Identity = 29/73 (39.73%), Postives = 43/73 (58.90%), Query Frame = 3
Query:  225 IFSGFKRDFLEDAFNVNRHIVDRLQGRNEDEEKGAIVKVKGGLSIISPPEKQARHQRGSRQEEDEDEEKQPRH 443
            + SGF  +FL  A N ++    RLQ   +  ++  IV+V+GGLSIIS PE Q   +   R  E+E++E + RH
Sbjct:  238 VLSGFSSEFLAQALNTDQDTAKRLQSPRD--QRSQIVRVEGGLSIIS-PEWQQEDEEYERSPEEEEDEGRSRH 307          
BLAST of CD859854 vs. Medicago proteins
Match: IMGA|Medtr1g072630.1 (Legumin B (AHRD V1 *-*- Q41703_VICSA); contains Interpro domain(s) IPR014710 RmlC-like jelly roll fold chr01_pseudomolecule_IMGAG_V3.5 18241766-18239526 E EGN_Mt100125 20100825)

HSP 1 Score: 52.373 bits (124), Expect = 1.843e-7
Identity = 29/73 (39.73%), Postives = 43/73 (58.90%), Query Frame = 3
Query:  225 IFSGFKRDFLEDAFNVNRHIVDRLQGRNEDEEKGAIVKVKGGLSIISPPEKQARHQRGSRQEEDEDEEKQPRH 443
            + SGF  +FL  A N ++    RLQ   +  ++  IV+V+GGLSIIS PE Q   +   R  E+E++E + RH
Sbjct:  238 VLSGFSSEFLAQALNTDQDTAKRLQSPRD--QRSQIVRVEGGLSIIS-PEWQQEDEEYERSPEEEEDEGRSRH 307          
The following BLAST results are available for this feature:
BLAST of CD859854 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Trembl)
Total hits: 10
Match NameE-valueIdentityDescription
Q9T0P5_PEA4.229e-3862.41LegA class OS=Pisum sativum GN=legA PE=2 SV=1[more]
Q41702_VICSA1.192e-3257.34Legumin A OS=Vicia sativa PE=2 SV=1[more]
Q99304_VICFA8.540e-3173.20Legumin A2 primary translation product OS=Vicia fa... [more]
Q03971_VICFA1.508e-2768.69N-terminal incomplete legumin A1 pre-pro-polypepti... [more]
Q41676_VICNA1.276e-2672.04Legumin A OS=Vicia narbonensis PE=2 SV=1[more]
B5U8K6_LOTJA6.135e-2153.19Legumin storage protein 5 OS=Lotus japonicus GN=ll... [more]
C6TGG8_SOYBN6.348e-1875.00Putative uncharacterized protein OS=Glycine max PE... [more]
D7TEG9_VITVI2.760e-1357.89Whole genome shotgun sequence of line PN40024, sca... [more]
D7KE97_ARALY6.149e-1358.93Putative uncharacterized protein OS=Arabidopsis ly... [more]
C7EA92_SOYBN6.149e-1352.86Mutant glycinin subunit A1aB1b OS=Glycine max GN=G... [more]
back to top
BLAST of CD859854 vs. SwissProt
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Swissprot)
Total hits: 10
Match NameE-valueIdentityDescription
LEGA_PEA6.846e-3961.70Legumin A OS=Pisum sativum GN=LEGA PE=1 SV=1[more]
LEGA2_PEA7.569e-3861.54Legumin A2 OS=Pisum sativum GN=LEGA2 PE=3 SV=1[more]
LEG_CICAR7.851e-2780.00Legumin OS=Cicer arietinum GN=leg3 PE=1 SV=1[more]
GLYG3_SOYBN4.468e-1455.41Glycinin G3 OS=Glycine max GN=GY3 PE=3 SV=1[more]
GLYG1_SOYBN4.468e-1452.86Glycinin G1 OS=Glycine max GN=GY1 PE=1 SV=2[more]
GLYG2_SOYBN2.452e-1248.61Glycinin G2 OS=Glycine max GN=Gy2 PE=1 SV=2[more]
AHY3_ARAHY9.317e-1253.13Arachin Ahy-3 OS=Arachis hypogaea PE=1 SV=1[more]
LEGB_PEA6.249e-839.19Legumin B (Fragment) OS=Pisum sativum GN=LEGB PE=2... [more]
GLYG4_SOYBN6.249e-839.71Glycinin G4 OS=Glycine max GN=GY4 PE=1 SV=1[more]
GLYG5_SOYBN5.290e-742.65Glycinin OS=Glycine max PE=1 SV=1[more]
back to top
BLAST of CD859854 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Pisum sativum unigene v1 vs TAIR 10 peptide)
Total hits: 1
Match NameE-valueIdentityDescription
AT1G04970.16.150e-1558.93| Symbols: | lipid-binding serum glycoprotein fam... [more]
back to top
BLAST of CD859854 vs. TAIR peptide
Analysis Date: 2011-04-21 (Homology Analysis: Pisum sativum unigene v2 vs TAIR 10 peptide)
Total hits: 1
Match NameE-valueIdentityDescription
AT1G04970.16.150e-1558.93| Symbols: | lipid-binding serum glycoprotein fam... [more]
back to top
BLAST of CD859854 vs. TrEMBL
Analysis Date: 2011-04-27 (Homology Analysis: Pisum sativum unigene v2 vs Trembl)
Total hits: 10
Match NameE-valueIdentityDescription
Q9T0P5_PEA5.179e-3862.41LegA class OS=Pisum sativum GN=legA PE=1 SV=1[more]
Q41702_VICSA1.460e-3257.34Legumin A OS=Vicia sativa PE=2 SV=1[more]
Q99304_VICFA1.046e-3055.17Legumin A2 primary translation product OS=Vicia fa... [more]
Q03971_VICFA1.846e-2752.38N-terminal incomplete legumin A1 pre-pro-polypepti... [more]
Q41676_VICNA1.563e-2653.15Legumin A OS=Vicia narbonensis PE=2 SV=1[more]
B5U8K6_LOTJA7.514e-2153.19Legumin storage protein 5 OS=Lotus japonicus GN=ll... [more]
C6TGG8_SOYBN7.775e-1875.00Putative uncharacterized protein OS=Glycine max PE... [more]
D7TEG9_VITVI3.380e-1357.89Whole genome shotgun sequence of line PN40024, sca... [more]
D7KE97_ARALY7.531e-1358.93Putative uncharacterized protein OS=Arabidopsis ly... [more]
C7EA92_SOYBN7.531e-1352.86Mutant glycinin subunit A1aB1b OS=Glycine max GN=G... [more]
back to top
BLAST of CD859854 vs. Lotus protein
Analysis Date: 2011-04-21 (Homology Analysis: Pisum sativum unigene v2 vs Lotus proteins)
Total hits: 7
Match NameE-valueIdentityDescription
chr1.CM0295.240.r2.d2.780e-2353.19+ phase: 0 [more]
chr1.CM0295.280.r2.d6.847e-2251.06- phase: 0 [more]
chr2.CM1285.90.r2.a9.887e-2176.79+ phase: 0 [more]
chr6.CM1514.340.r2.m1.026e-952.83+ phase: 0 [more]
chr2.CM0667.100.r2.a5.627e-844.44- phase: 0 [more]
chr2.CM0667.70.r2.a5.627e-844.44- phase: 0 [more]
chr1.CM0295.230.r2.m7.349e-839.19- phase: 0 [more]
back to top
BLAST of CD859854 vs. Soybean peptides
Analysis Date: 2011-04-21 (Homology Analysis: Pisum sativum unigene v2 vs Soybean peptides)
Total hits: 10
Match NameE-valueIdentityDescription
Glyma14g05590.1|PACid:162944677.312e-2075.00[more]
Glyma02g43390.1|PACid:162500171.167e-1767.86[more]
Glyma19g34780.1|PACid:163137707.082e-1555.41[more]
Glyma03g32030.1|PACid:162530197.082e-1552.86[more]
Glyma03g32020.2|PACid:162530183.886e-1348.61[more]
Glyma03g32020.1|PACid:162530173.886e-1348.61[more]
Glyma18g10070.1|PACid:163084534.446e-950.94[more]
Glyma10g04280.1|PACid:162785354.446e-941.18[more]
Glyma02g46500.1|PACid:162504072.882e-846.30[more]
Glyma13g18450.1|PACid:162907218.385e-842.65[more]
back to top
BLAST of CD859854 vs. SwissProt
Analysis Date: 2011-04-21 (Homology Analysis: Pisum sativum unigene v2 vs Swissprot)
Total hits: 10
Match NameE-valueIdentityDescription
LEGA_PEA6.970e-3961.70Legumin A OS=Pisum sativum GN=LEGA PE=1 SV=1[more]
LEGA2_PEA7.706e-3861.54Legumin A2 OS=Pisum sativum GN=LEGA2 PE=3 SV=1[more]
LEG_CICAR7.993e-2780.00Legumin OS=Cicer arietinum GN=leg3 PE=1 SV=1[more]
GLYG3_SOYBN4.549e-1455.41Glycinin G3 OS=Glycine max GN=GY3 PE=3 SV=1[more]
GLYG1_SOYBN4.549e-1452.86Glycinin G1 OS=Glycine max GN=GY1 PE=1 SV=2[more]
GLYG2_SOYBN2.496e-1248.61Glycinin G2 OS=Glycine max GN=Gy2 PE=1 SV=2[more]
AHY3_ARAHY9.486e-1253.13Arachin Ahy-3 OS=Arachis hypogaea PE=1 SV=1[more]
LEGB_PEA6.363e-839.19Legumin B (Fragment) OS=Pisum sativum GN=LEGB PE=2... [more]
GLYG4_SOYBN6.363e-839.71Glycinin G4 OS=Glycine max GN=GY4 PE=1 SV=1[more]
GLYG5_SOYBN5.387e-742.65Glycinin OS=Glycine max PE=1 SV=1[more]
back to top
BLAST of CD859854 vs. Medicago proteins
Analysis Date: 2011-04-21 (Homology Analysis: Pisum sativum unigene v2 vs Medicago proteins)
Total hits: 10
Match NameE-valueIdentityDescription
IMGA|Medtr5g084690.15.715e-1766.07Unknown Protein (AHRD V1); contains Interpro domai... [more]
IMGA|Medtr5g093980.22.571e-944.44Unknown Protein (AHRD V1); contains Interpro domai... [more]
IMGA|Medtr5g093980.12.571e-944.44Bactericidal permeability-increasing protein (Frag... [more]
IMGA|Medtr1g072610.35.728e-941.10Legumin K (Fragment) (AHRD V1 *-*- P05693); contai... [more]
IMGA|Medtr1g072630.25.728e-941.10Legumin B (Fragment) (AHRD V1 ***- P14594); contai... [more]
IMGA|Medtr1g072610.25.728e-941.10Legumin B (Fragment) (AHRD V1 ***- P14594); contai... [more]
IMGA|Medtr1g072610.15.728e-941.10Legumin B (Fragment) (AHRD V1 ***- P14594); contai... [more]
IMGA|Medtr1g072600.15.728e-941.10Legumin B (Fragment) (AHRD V1 *-*- P14594); contai... [more]
IMGA|Medtr1g072630.31.843e-739.73Legumin B (AHRD V1 *-*- Q41703_VICSA); contains In... [more]
IMGA|Medtr1g072630.11.843e-739.73Legumin B (AHRD V1 *-*- Q41703_VICSA); contains In... [more]
back to top
InterPro
Analysis Name: InterProScan analysis for Pisum sativum unigene v2
Date Performed: 2011-04-27
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableSEGsegsegcoord: 15..25
score: NAcoord: 33..42
score: NAcoord: 48..75
score
NoneNo IPR availableSEGsegsegcoord: 12..37
score
NoneNo IPR availableSEGsegsegcoord: 14..29
score: NAcoord: 104..139
score
NoneNo IPR availableSEGsegsegcoord: 14..30
score: NAcoord: 31..47
score
NoneNo IPR availableSEGsegsegcoord: 5..13
score: NAcoord: 25..31
score
NoneNo IPR availableGENE3D3.15.10.10no descriptioncoord: 6..60
score: 2.6
NoneNo IPR availablePANTHERPTHR10504BACTERICIDAL PERMEABILITY-INCREASING (BPI) PROTEINcoord: 5..60
score: 1.7
NoneNo IPR availablePANTHERPTHR10504:SF15BACTERICIDAL /PERMEABILITY-INCREASING PROTEIN-RELATEDcoord: 5..60
score: 1.7
NoneNo IPR availableSEGsegsegcoord: 1..28
score: NAcoord: 31..72
score: NAcoord: 122..139
score
IPR011051Cupin, RmlC-typeSUPERFAMILY51182RmlC-like cupinscoord: 10..77
score: 3.9
IPR014710RmlC-like jelly roll foldGENE3D2.60.120.10no descriptioncoord: 13..79
score: 3

Analysis Name: InterProScan analysis for Pisum sativum unigene v1
Date Performed: 2010-12-29
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableSEGsegsegcoord: 1..28
score: NAcoord: 31..72
score: NAcoord: 122..139
score
NoneNo IPR availableSEGsegsegcoord: 15..25
score: NAcoord: 33..42
score: NAcoord: 48..75
score
NoneNo IPR availableSEGsegsegcoord: 12..37
score
NoneNo IPR availableSEGsegsegcoord: 14..29
score: NAcoord: 104..139
score
NoneNo IPR availableSEGsegsegcoord: 14..30
score: NAcoord: 31..47
score
NoneNo IPR availableSEGsegsegcoord: 5..13
score: NAcoord: 25..31
score
NoneNo IPR availableGENE3D3.15.10.10no descriptioncoord: 6..60
score: 2.6
NoneNo IPR availablePANTHERPTHR10504BACTERICIDAL PERMEABILITY-INCREASING (BPI) PROTEINcoord: 5..60
score: 1.7
NoneNo IPR availablePANTHERPTHR10504:SF15BACTERICIDAL /PERMEABILITY-INCREASING PROTEIN-RELATEDcoord: 5..60
score: 1.7
IPR011051Cupin, RmlC-typeSUPERFAMILY51182RmlC-like cupinscoord: 10..77
score: 3.9
IPR014710RmlC-like jelly roll foldGENE3D2.60.120.10no descriptioncoord: 13..79
score: 3

Properties
Property NameValue
Singlet in analysisPisum sativum unigene v2
Singlet in analysisPisum sativum unigene v1
Sequences
The following sequences are available for this feature:

EST sequence

>CD859854 ID=CD859854|Name=CD859854|organism=Pisum sativum|type=EST|length=587bp
TATAATCGTAATACCAATTCATACTCAAATTACAACTAACCCCAGAAGCA
ACAATCGAAATCCCACTCTCTCCAGGCTTAACAACCGAGGAAGGAACATC
AATTTGATAAATTGTGATATCAGAAAGCATCAAGTAAACATTACCCAAAA
ACGGAATCTTTGTGTTTCTACGATACCAGCATCAACAAGGAGGAAAGCAA
GAACAAGAAAATGAAGGCAACAACATTTTCAGTGGCTTCAAGAGGGATTT
CTTGGAAGATGCTTTCAACGTGAACAGGCATATAGTAGACAGACTTCAAG
GCAGGAATGAAGACGAAGAGAAGGGAGCCATTGTCAAAGTGAAAGGTGGA
CTCAGCATCATAAGCCCACCCGAGAAGCAAGCGCGCCACCAGAGAGGCAG
CAGACAAGAGGAAGATGAAGATGAAGAGAAGCAGCCGCGCCACCAGAGAG
GCAGCAGACAAGAGGAAGAGGAAGATGAAGATGAAGAGAGGCAGCCGCGT
CATCAAAGGAGAAGAGGAGAGGAGGAAGAAGAAGACAAGAAAGAGCGCCG
CGGCAGCCAAAAAGGCAAAAGCAGAAGGCAAGGAGAC
back to top
Annotated Terms
The following terms have been associated with this EST:
Vocabulary: INTERPRO
TermDefinition
IPR011051RmlC_Cupin_sf
IPR014710RmlC-like_jellyroll