GH720859
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of GH720859 vs. TrEMBL
Match: A5BBB7_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VITISV_019326 PE=4 SV=1) HSP 1 Score: 69.707 bits (169), Expect = 1.067e-10 Identity = 30/47 (63.83%), Postives = 38/47 (80.85%), Query Frame = 2 Query: 23 VLEAPKMNFMDRIHLPPVSGGLHNETGVRKIAKKTKCFSNSVFNCAC 163 +L+AP +NFMDRIH+ P + L +ETGVRKIA K KCF NSVF+C+C Sbjct: 854 ILDAPTINFMDRIHVSPHNARLSHETGVRKIATKAKCFGNSVFHCSC 900
BLAST of GH720859 vs. TrEMBL
Match: D7TS96_VITVI (Whole genome shotgun sequence of line PN40024, scaffold_51.assembly12x (Fragment) OS=Vitis vinifera GN=VIT_00029084001 PE=4 SV=1) HSP 1 Score: 67.781 bits (164), Expect = 4.055e-10 Identity = 29/47 (61.70%), Postives = 38/47 (80.85%), Query Frame = 2 Query: 23 VLEAPKMNFMDRIHLPPVSGGLHNETGVRKIAKKTKCFSNSVFNCAC 163 +L+AP +NFM+RIH+ P + L +ETGVRKIA K KCF NSVF+C+C Sbjct: 62 ILDAPTINFMERIHVSPHNARLPHETGVRKIATKAKCFGNSVFHCSC 108
BLAST of GH720859 vs. TrEMBL
Match: B9RWK0_RICCO (Putative uncharacterized protein OS=Ricinus communis GN=RCOM_1020360 PE=4 SV=1) HSP 1 Score: 61.6178 bits (148), Expect = 2.906e-8 Identity = 28/47 (59.57%), Postives = 36/47 (76.60%), Query Frame = 2 Query: 23 VLEAPKMNFMDRIHLPPVSGGLHNETGVRKIAKKTKCFSNSVFNCAC 163 +LEAPK+N MDR+ L P + +++GVRKIA K KCF NSVF+CAC Sbjct: 922 ILEAPKINIMDRLLLSPSTRFSLHDSGVRKIATKAKCFGNSVFHCAC 968 The following BLAST results are available for this feature:
BLAST of GH720859 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Trembl) Total hits: 3
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >GH720859 ID=GH720859; Name=GH720859; organism=Pisum sativum; type=EST; length=345bpback to top |