AM162151
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of AM162151 vs. TrEMBL
Match: D7SJ29_VITVI (Whole genome shotgun sequence of line PN40024, scaffold_0.assembly12x (Fragment) OS=Vitis vinifera GN=VIT_00008332001 PE=4 SV=1) HSP 1 Score: 61.6178 bits (148), Expect = 6.275e-12 Identity = 26/42 (61.90%), Postives = 35/42 (83.33%), Query Frame = -2 Query: 243 KNGVSDNQLANSLLQAADNWLRLVQVNHPDYKFFVSHGTYHK 368 +NG ++Q NSL+QAADN LRL++VNHPD++FFVSHG Y + Sbjct: 326 QNGTCEHQRVNSLVQAADNRLRLLEVNHPDFQFFVSHGMYRR 367 HSP 2 Score: 32.3426 bits (72), Expect = 6.275e-12 Identity = 13/16 (81.25%), Postives = 13/16 (81.25%), Query Frame = -1 Query: 373 LPTFAMASYKLKGSIW 420 LP F MASYK KGSIW Sbjct: 309 LPVFGMASYKFKGSIW 324
BLAST of AM162151 vs. TrEMBL
Match: B9HX03_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_833344 PE=4 SV=1) HSP 1 Score: 65.0846 bits (157), Expect = 1.056e-11 Identity = 29/38 (76.32%), Postives = 34/38 (89.47%), Query Frame = -2 Query: 252 NGVSDNQLANSLLQAADNWLRLVQVNHPDYKFFVSHGT 365 NGV + Q A+SLL+AADNWLRL+QVNHPDY+FFVSH T Sbjct: 357 NGVYECQKASSLLRAADNWLRLLQVNHPDYRFFVSHNT 394 HSP 2 Score: 28.1054 bits (61), Expect = 1.056e-11 Identity = 11/16 (68.75%), Postives = 12/16 (75.00%), Query Frame = -1 Query: 373 LPTFAMASYKLKGSIW 420 LPTF +ASYK K S W Sbjct: 339 LPTFGLASYKFKVSFW 354
BLAST of AM162151 vs. TrEMBL
Match: B9N000_POPTR (Predicted protein (Fragment) OS=Populus trichocarpa GN=POPTRDRAFT_295925 PE=4 SV=1) HSP 1 Score: 63.5438 bits (153), Expect = 1.880e-10 Identity = 28/38 (73.68%), Postives = 33/38 (86.84%), Query Frame = -2 Query: 252 NGVSDNQLANSLLQAADNWLRLVQVNHPDYKFFVSHGT 365 NGV + Q + SLL+AADNWLRL+QVNHPDY+FFVSH T Sbjct: 275 NGVYECQKSGSLLKAADNWLRLLQVNHPDYRFFVSHNT 312 HSP 2 Score: 25.409 bits (54), Expect = 1.880e-10 Identity = 9/16 (56.25%), Postives = 12/16 (75.00%), Query Frame = -1 Query: 373 LPTFAMASYKLKGSIW 420 LPTF +ASYK + + W Sbjct: 257 LPTFGLASYKFEVTFW 272
BLAST of AM162151 vs. TrEMBL
Match: B9HJ57_POPTR (Predicted protein (Fragment) OS=Populus trichocarpa GN=POPTRDRAFT_719815 PE=4 SV=1) HSP 1 Score: 55.8398 bits (133), Expect = 1.173e-9 Identity = 24/33 (72.73%), Postives = 28/33 (84.85%), Query Frame = -2 Query: 267 NGVSDNQLANSLLQAADNWLRLVQVNHPDYKFF 365 NG D+QL+NSL QAAD WLRL+QVNHPD+ FF Sbjct: 241 NGECDHQLSNSLFQAADKWLRLLQVNHPDFLFF 273 HSP 2 Score: 30.4166 bits (67), Expect = 1.173e-9 Identity = 11/16 (68.75%), Postives = 13/16 (81.25%), Query Frame = -1 Query: 373 LPTFAMASYKLKGSIW 420 LP F +ASYK KGS+W Sbjct: 223 LPVFGLASYKFKGSLW 238
BLAST of AM162151 vs. TrEMBL
Match: B9SM03_RICCO (Putative uncharacterized protein OS=Ricinus communis GN=RCOM_1311110 PE=4 SV=1) HSP 1 Score: 56.6102 bits (135), Expect = 2.527e-9 Identity = 26/33 (78.79%), Postives = 29/33 (87.88%), Query Frame = -2 Query: 267 NGVSDNQLANSLLQAADNWLRLVQVNHPDYKFF 365 +G S+ QLANSLLQAADNWLRLVQV HPD+ FF Sbjct: 384 SGGSERQLANSLLQAADNWLRLVQVYHPDFVFF 416 HSP 2 Score: 28.4906 bits (62), Expect = 2.527e-9 Identity = 10/16 (62.50%), Postives = 12/16 (75.00%), Query Frame = -1 Query: 373 LPTFAMASYKLKGSIW 420 LP F +ASYK KG +W Sbjct: 366 LPVFGLASYKFKGPLW 381
BLAST of AM162151 vs. TrEMBL
Match: Q9M9Q2_ARATH (Putative uncharacterized protein At1g15030 OS=Arabidopsis thaliana GN=At1g15030 PE=2 SV=1) HSP 1 Score: 53.9138 bits (128), Expect = 2.539e-9 Identity = 25/32 (78.12%), Postives = 27/32 (84.38%), Query Frame = -2 Query: 267 GVSDNQLANSLLQAADNWLRLVQVNHPDYKFF 362 G S +QLANSL QAADNWLRL QVNHPD+ FF Sbjct: 326 GGSGHQLANSLFQAADNWLRLRQVNHPDFIFF 357 HSP 2 Score: 31.187 bits (69), Expect = 2.539e-9 Identity = 11/16 (68.75%), Postives = 14/16 (87.50%), Query Frame = -1 Query: 373 LPTFAMASYKLKGSIW 420 LP F +ASYKL+GS+W Sbjct: 307 LPVFGLASYKLRGSVW 322
BLAST of AM162151 vs. TrEMBL
Match: D7SY72_VITVI (Whole genome shotgun sequence of line PN40024, scaffold_77.assembly12x (Fragment) OS=Vitis vinifera GN=VIT_00035053001 PE=4 SV=1) HSP 1 Score: 65.0846 bits (157), Expect = 2.606e-9 Identity = 28/41 (68.29%), Postives = 35/41 (85.37%), Query Frame = -2 Query: 243 NGVSDNQLANSLLQAADNWLRLVQVNHPDYKFFVSHGTYHK 365 NGV++ ANSLL+AADNWLR +QVNHPDY+FFVSH +Y + Sbjct: 387 NGVNECPKANSLLRAADNWLRSLQVNHPDYQFFVSHNSYRR 427
BLAST of AM162151 vs. TrEMBL
Match: D7KCM3_ARALY (Putative uncharacterized protein OS=Arabidopsis lyrata subsp. lyrata GN=ARALYDRAFT_888896 PE=4 SV=1) HSP 1 Score: 51.6026 bits (122), Expect = 1.211e-8 Identity = 23/30 (76.67%), Postives = 26/30 (86.67%), Query Frame = -2 Query: 267 SDNQLANSLLQAADNWLRLVQVNHPDYKFF 356 S +Q+ANSL QAADNWLRL QVNHPD+ FF Sbjct: 328 SGHQVANSLFQAADNWLRLRQVNHPDFIFF 357 HSP 2 Score: 31.187 bits (69), Expect = 1.211e-8 Identity = 11/16 (68.75%), Postives = 14/16 (87.50%), Query Frame = -1 Query: 373 LPTFAMASYKLKGSIW 420 LP F +ASYKL+GS+W Sbjct: 307 LPVFGLASYKLRGSVW 322
BLAST of AM162151 vs. TrEMBL
Match: B9RZK3_RICCO (Putative uncharacterized protein OS=Ricinus communis GN=RCOM_0999300 PE=4 SV=1) HSP 1 Score: 56.6102 bits (135), Expect = 2.631e-8 Identity = 25/38 (65.79%), Postives = 29/38 (76.32%), Query Frame = -2 Query: 252 NGVSDNQLANSLLQAADNWLRLVQVNHPDYKFFVSHGT 365 NG + Q NSLL+AADNWLRL+QV HPDY FF SH + Sbjct: 376 NGAYECQKVNSLLRAADNWLRLLQVYHPDYMFFASHNS 413 HSP 2 Score: 25.0238 bits (53), Expect = 2.631e-8 Identity = 10/16 (62.50%), Postives = 11/16 (68.75%), Query Frame = -1 Query: 373 LPTFAMASYKLKGSIW 420 L TF +ASYK K S W Sbjct: 358 LATFGLASYKFKVSFW 373
BLAST of AM162151 vs. TrEMBL
Match: B9HWD9_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_658850 PE=4 SV=1) HSP 1 Score: 51.9878 bits (123), Expect = 2.635e-8 Identity = 24/33 (72.73%), Postives = 27/33 (81.82%), Query Frame = -2 Query: 267 NGVSDNQLANSLLQAADNWLRLVQVNHPDYKFF 365 NG D QLANSLLQAA +LRL+QVNHPD+ FF Sbjct: 357 NGGGDRQLANSLLQAASKFLRLLQVNHPDFLFF 389 HSP 2 Score: 29.6462 bits (65), Expect = 2.635e-8 Identity = 11/16 (68.75%), Postives = 12/16 (75.00%), Query Frame = -1 Query: 373 LPTFAMASYKLKGSIW 420 LP F ASYK KGS+W Sbjct: 339 LPVFGFASYKFKGSLW 354
BLAST of AM162151 vs. TAIR peptide
Match: AT1G15030.1 (| Symbols: | Protein of unknown function (DUF789) | chr1:5177895-5179853 FORWARD LENGTH=360) HSP 1 Score: 53.9138 bits (128), Expect = 1.519e-11 Identity = 25/32 (78.12%), Postives = 27/32 (84.38%), Query Frame = -2 Query: 267 GVSDNQLANSLLQAADNWLRLVQVNHPDYKFF 362 G S +QLANSL QAADNWLRL QVNHPD+ FF Sbjct: 326 GGSGHQLANSLFQAADNWLRLRQVNHPDFIFF 357 HSP 2 Score: 31.187 bits (69), Expect = 1.519e-11 Identity = 11/16 (68.75%), Postives = 14/16 (87.50%), Query Frame = -1 Query: 373 LPTFAMASYKLKGSIW 420 LP F +ASYKL+GS+W Sbjct: 307 LPVFGLASYKLRGSVW 322
BLAST of AM162151 vs. TAIR peptide
Match: AT5G49220.1 (| Symbols: | Protein of unknown function (DUF789) | chr5:19956627-19958453 FORWARD LENGTH=409) HSP 1 Score: 49.6766 bits (117), Expect = 3.434e-10 Identity = 20/37 (54.05%), Postives = 29/37 (78.38%), Query Frame = -2 Query: 258 KNGVSDNQLANSLLQAADNWLRLVQVNHPDYKFFVSH 368 +N + ++Q SLLQAAD WL+ +QV+HPDY+FF S+ Sbjct: 368 QNRIQESQKMTSLLQAADKWLKRLQVDHPDYRFFTSN 404 HSP 2 Score: 30.8018 bits (68), Expect = 3.434e-10 Identity = 12/16 (75.00%), Postives = 14/16 (87.50%), Query Frame = -1 Query: 373 LPTFAMASYKLKGSIW 420 LPTF +ASYKLK S+W Sbjct: 351 LPTFGLASYKLKVSVW 366
BLAST of AM162151 vs. TAIR peptide
Match: AT2G01260.1 (| Symbols: | Protein of unknown function (DUF789) | chr2:135494-137504 REVERSE LENGTH=369) HSP 1 Score: 44.2838 bits (103), Expect = 3.676e-8 Identity = 19/32 (59.38%), Postives = 23/32 (71.88%), Query Frame = -2 Query: 267 GVSDNQLANSLLQAADNWLRLVQVNHPDYKFF 362 G S++QL NSL QAAD WL V+HPD+ FF Sbjct: 335 GGSEHQLVNSLFQAADKWLHSCHVSHPDFLFF 366 HSP 2 Score: 29.261 bits (64), Expect = 3.676e-8 Identity = 10/16 (62.50%), Postives = 13/16 (81.25%), Query Frame = -1 Query: 373 LPTFAMASYKLKGSIW 420 LP F +ASYK +GS+W Sbjct: 316 LPVFGLASYKFRGSLW 331 The following BLAST results are available for this feature:
BLAST of AM162151 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Trembl) Total hits: 10
BLAST of AM162151 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Pisum sativum unigene v1 vs TAIR 10 peptide) Total hits: 3
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >AM162151 ID=AM162151; Name=AM162151; organism=Pisum sativum; type=EST; length=420bpback to top |