AJ308164
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of AJ308164 vs. Lotus protein
Match: chr3.CM0460.270.r2.d (+ phase: 0 ) HSP 1 Score: 50.8322 bits (120), Expect = 1.338e-7 Identity = 21/30 (70.00%), Postives = 25/30 (83.33%), Query Frame = 1 Query: 1 KETEKFVSIQKTVFVARSCGLKLPAGMQCG 90 K+ EK VS+ K +FVARSCGL +PAGMQCG Sbjct: 77 KDVEKLVSVPKAIFVARSCGLNVPAGMQCG 106
BLAST of AJ308164 vs. Medicago proteins
Match: IMGA|Medtr4g076150.1 (Seed specific protein Bn15D18B (AHRD V1 ***- Q7XYW1_BRANA); contains Interpro domain(s) IPR003612 Plant lipid transfer protein/seed storage/trypsin-alpha amylase inhibitor chr04_pseudomolecule_IMGAG_V3.5 24516493-24515813 F EGN_Mt100125 20100825) HSP 1 Score: 72.0182 bits (175), Expect = 8.109e-14 Identity = 32/40 (80.00%), Postives = 37/40 (92.50%), Query Frame = 1 Query: 1 KETEKFVSIQKTVFVARSCGLKLPAGMQCGSVKLPPKAMK 120 KE EKFVS+QK + VARSCGLK+PAGMQCGSV++PPKAMK Sbjct: 76 KEMEKFVSVQKAISVARSCGLKVPAGMQCGSVRVPPKAMK 115 The following BLAST results are available for this feature:
BLAST of AJ308164 vs. Lotus protein
Analysis Date: 2011-04-21 (Homology Analysis: Pisum sativum unigene v2 vs Lotus proteins) Total hits: 1
BLAST of AJ308164 vs. Medicago proteins
Analysis Date: 2011-04-21 (Homology Analysis: Pisum sativum unigene v2 vs Medicago proteins) Total hits: 1
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >AJ308164 ID=AJ308164; Name=AJ308164; organism=Pisum sativum; type=EST; length=294bpback to top |