Va09G048410.1
Transcript Overview
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses Orthologs
Syntenic blocks
Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Homology
BLAST of Va09G048410.1 vs. UniProtKB/TrEMBL
Match: tr|A0A0L9VDS5|A0A0L9VDS5_PHAAN (Uncharacterized protein OS=Phaseolus angularis OX=3914 GN=LR48_Vigan09g172600 PE=4 SV=1) HSP 1 Score: 80.8777 bits (198), Expect = 3.155e-16 Identity = 49/84 (58.33%), Postives = 60/84 (71.43%), Query Frame = 0 Query: 5 SRIGRPRTGRSPKSWTFAQGLDVRPTIGRPPNGFDVRPRAGRPPRGVWSSAKYGRTPVQLGAESEGPSARSGVRPPARERGASV 88 +++ RP + P WTFAQGLDVRP IGRPP VRPRAGRPPRG ++ + GRTP +LGAES+G SAR G RP + + ASV Sbjct: 45 AKVERPPSEERPPMWTFAQGLDVRPRIGRPPKQRIVRPRAGRPPRG-GAALRRGRTPARLGAESKGSSARRGGRPSSLVQRASV 127
BLAST of Va09G048410.1 vs. UniProtKB/TrEMBL
Match: tr|A0A0L9U999|A0A0L9U999_PHAAN (mannan endo-1,4-beta-mannosidase OS=Phaseolus angularis OX=3914 GN=LR48_Vigan03g267800 PE=3 SV=1) HSP 1 Score: 68.1662 bits (165), Expect = 3.393e-10 Identity = 42/66 (63.64%), Postives = 44/66 (66.67%), Query Frame = 0 Query: 76 GVRPPARERGASVWSRRTSARFGARSSDRPSLCR-PASAASFGSWDSAGRPLGPCIFVVRSSVFNS 140 G RPP E ASVWSRRTSARFGA SSDRPSLCR P AS P GPCIFVV SVF++ Sbjct: 46 GGRPPGLEHRASVWSRRTSARFGAWSSDRPSLCRPPVQLASVRGIQQC--PPGPCIFVVCPSVFDT 109 The following BLAST results are available for this feature:
BLAST of Va09G048410.1 vs. UniProtKB/TrEMBL
Analysis Date: 2024-05-23 (Blastp of Vigna angularis cv. Jingnong6 v1.7.1 proteins vs UniProt TrEMBL) Total hits: 2
BLAST of Va09G048410.1 vs. UniProtKB/TrEMBL
Analysis Date: 2024-05-23 (Blastp of Vigna angularis cv. Jingnong6 v1.7.1 proteins vs UniProt Swissprot) Total hits: 0
BLAST of Va09G048410.1 vs. UniProtKB/TrEMBL
Analysis Date: 2024-05-23 (Blastp of Vigna angularis cv. Jingnong6 v1.7.1 proteins vs arabidopsis Araport11) Total hits: 0
Sequences
The
following sequences are available for this feature:
mRNA sequence >Va09G048410.1_Jingnong6 ID=Va09G048410.1_Jingnong6; Name=Va09G048410.1; organism=Vigna angularis; type=mRNA; length=492bpback to top protein sequence of Va09G048410.1_Jingnong6 >Va09G048410.1_Jingnong6 ID=Va09G048410.1_Jingnong6; Name=Va09G048410.1_Jingnong6; organism=Vigna angularis; type=polypeptide; length=163bpback to top mRNA from alignment at Chr9:27683286..27684653- Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.>Va09G048410.1_Jingnong6 ID=Va09G048410.1_Jingnong6; Name=Va09G048410.1; organism=Vigna angularis; type=mRNA; length=1368bp; location=Sequence derived from: Chr9:27683286..27684653- (Vigna angularisback to top Coding sequence (CDS) from alignment at Chr9:27683286..27684653- >Va09G048410.1_Jingnong6 ID=Va09G048410.1_Jingnong6; Name=Va09G048410.1; organism=Vigna angularis; type=CDS; length=492bp; location=Sequence derived from: Chr9:27683286..27684653- (Vigna angularisback to top |