Vigun11g008800.1
Transcript Overview
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses Orthologs
Syntenic blocks Gene/transcripts from the same species that appear to represent the same gene
Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following three_prime_UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following five_prime_UTR feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Homology
BLAST of Vigun11g008800.1 vs. ExPASy TrEMBL (2024)
Match: tr|A0A4D6LC23|A0A4D6LC23_VIGUN (Uncharacterized protein OS=Vigna unguiculata OX=3917 GN=DEO72_LG3g385 PE=4 SV=1) HSP 1 Score: 103.219 bits (256), Expect = 4.617e-27 Identity = 53/68 (77.94%), Postives = 54/68 (79.41%), Query Frame = 0 Query: 1 MSSYSQNCCRRTLFSETVRRDARN----------AAVNQMNDSISFTAKTLRYHQRQENMATSSVNLV 58 MSSYSQNCCRR L S+TVRRD RN AAVNQMNDSISFTAKTLRYHQRQENM TSSVNLV Sbjct: 1 MSSYSQNCCRRKLLSDTVRRDPRNVISMHKKSRYAAVNQMNDSISFTAKTLRYHQRQENMTTSSVNLV 68
BLAST of Vigun11g008800.1 vs. ExPASy TrEMBL (2024)
Match: tr|A0A4D6LF93|A0A4D6LF93_VIGUN (Uncharacterized protein OS=Vigna unguiculata OX=3917 GN=DEO72_LG3g1761 PE=4 SV=1) HSP 1 Score: 80.4925 bits (197), Expect = 2.294e-18 Identity = 37/40 (92.50%), Postives = 38/40 (95.00%), Query Frame = 0 Query: 30 MNDSISFTAKTLRYHQRQENMATSSVNLVDVSKAGGGKLA 69 MNDSISFTAK LRYHQRQENM+TSSVNLVDVSKAGGGKL Sbjct: 1 MNDSISFTAKILRYHQRQENMSTSSVNLVDVSKAGGGKLV 40 The following BLAST results are available for this feature:
BLAST of Vigun11g008800.1 vs. ExPASy TrEMBL (2024)
Analysis Date: 2024-08-19 (Blastp of Vigna unguiculata L. Walp IT97K-499-35 v1.2 proteins vs UniProt TrEMBL) Total hits: 2
BLAST of Vigun11g008800.1 vs. ExPASy TrEMBL (2024)
Analysis Date: 2024-08-19 (Blastp of Vigna unguiculata L. Walp IT97K-499-35 v1.2 proteins vs UniProt Swissprot) Total hits: 0
BLAST of Vigun11g008800.1 vs. ExPASy TrEMBL (2024)
Analysis Date: 2024-08-19 (Blastp of Vigna unguiculata L. Walp IT97K-499-35 v1.2 proteins vs arabidopsis Araport11) Total hits: 0
Sequences
The
following sequences are available for this feature:
mRNA sequence >drVigUngu.IT97K.1.2.Vigun11g008800.1.v1.2 ID=drVigUngu.IT97K.1.2.Vigun11g008800.1.v1.2; Name=Vigun11g008800.1; organism=Vigna unguiculata; type=mRNA; length=237bpback to top protein sequence of drVigUngu.IT97K.1.2.Vigun11g008800.1.v1.2 >drVigUngu.IT97K.1.2.Vigun11g008800.1.v1.2 ID=drVigUngu.IT97K.1.2.Vigun11g008800.1.v1.2; Name=drVigUngu.IT97K.1.2.Vigun11g008800.1.v1.2; organism=Vigna unguiculata; type=polypeptide; length=79bpback to top mRNA from alignment at Vu11:1018652..1019650- Legend: exonfive_prime_UTRpolypeptideCDSthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.>drVigUngu.IT97K.1.2.Vigun11g008800.1.v1.2 ID=drVigUngu.IT97K.1.2.Vigun11g008800.1.v1.2; Name=Vigun11g008800.1; organism=Vigna unguiculata; type=mRNA; length=999bp; location=Sequence derived from: Vu11:1018652..1019650- (Vigna unguiculataback to top Coding sequence (CDS) from alignment at Vu11:1018652..1019650- >drVigUngu.IT97K.1.2.Vigun11g008800.1.v1.2 ID=drVigUngu.IT97K.1.2.Vigun11g008800.1.v1.2; Name=Vigun11g008800.1; organism=Vigna unguiculata; type=CDS; length=237bp; location=Sequence derived from: Vu11:1018652..1019650- (Vigna unguiculataback to top |