Ca_01897, Ca_01897_v1.0_kabuli (mRNA) Cicer arietinum
Transcript Overview
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Orthologs
Syntenic blocks Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Homology
BLAST of Ca_01897 vs. TrEMBL
Match: I1MW58_SOYBN (Uncharacterized protein OS=Glycine max PE=4 SV=1) HSP 1 Score: 111.309 bits (277), Expect = 1.184e-22 Identity = 49/53 (92.45%), Postives = 50/53 (94.34%), Query Frame = 1 Query: 121 RQFGSYLPLVLKGELRGANPSTRGLGWANLWCTGCYANSSAGLLSWYGRTAAP 279 RQFGSYLPLVLKG+LRGANPS RGLGWANLWCTGCYANSS GLLSWYGRT AP Sbjct: 8 RQFGSYLPLVLKGKLRGANPSMRGLGWANLWCTGCYANSSVGLLSWYGRTVAP 60 The following BLAST results are available for this feature:
BLAST of Ca_01897 vs. TrEMBL
Analysis Date: 2013-10-24 (Homology Analysis: Kabuli C.arietinum mRNA vs TrEMBL) Total hits: 1
BLAST of Ca_01897 vs. DB:Swiss
Analysis Date: 2019-05-21 (BLAST: C. arietinum CDC Frontier (kabuli), Swissprot) Total hits: 0
Sequences
The
following sequences are available for this feature:
mRNA sequence >Ca_01897_v1.0_kabuli ID=Ca_01897_v1.0_kabuli; Name=Ca_01897; organism=Cicer arietinum; type=mRNA; length=351bpback to top protein sequence of Ca_01897_v1.0_kabuli >Ca_01897_v1.0_kabuli ID=Ca_01897_v1.0_kabuli; Name=Ca_01897_v1.0_kabuli; organism=Cicer arietinum; type=polypeptide; length=116bpback to top mRNA from alignment at Ca5:33599817..33600167- Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.>Ca_01897_v1.0_kabuli ID=Ca_01897_v1.0_kabuli; Name=Ca_01897; organism=Cicer arietinum; type=mRNA; length=351bp; location=Sequence derived from: Ca5:33599817..33600167- (Cicer arietinumback to top Coding sequence (CDS) from alignment at Ca5:33599817..33600167- >Ca_01897_v1.0_kabuli ID=Ca_01897_v1.0_kabuli; Name=Ca_01897; organism=Cicer arietinum; type=CDS; length=351bp; location=Sequence derived from: Ca5:33599817..33600167- (Cicer arietinumback to top |