Cicer_arietinum_v1_Contig1069
Contig Overview
Alignments
The following features are aligned
Unigenes
This contig is part of the following unigenes:
Analyses
This contig is derived from or has results from the following analyses
Relationships
The following EST feature(s) are a part of this contig:
Homology
BLAST of Cicer_arietinum_v1_Contig1069 vs. TAIR peptide
Match: AT3G59540.1 (| Symbols: | Ribosomal L38e protein family | chr3:21995897-21996742 REVERSE LENGTH=69) HSP 1 Score: 51.9878 bits (123), Expect = 2.304e-7 Identity = 23/34 (67.65%), Postives = 27/34 (79.41%), Query Frame = 3 Query: 297 IKAQNNQYPLCVFDTDKADKLKQSLPPGLTVQDL 398 ++ Y LCVFD +KADKLKQSLPPGL+VQDL Sbjct: 36 VRCSRYLYTLCVFDQEKADKLKQSLPPGLSVQDL 69
BLAST of Cicer_arietinum_v1_Contig1069 vs. TAIR peptide
Match: AT2G43460.1 (| Symbols: | Ribosomal L38e protein family | chr2:18046285-18047292 REVERSE LENGTH=69) HSP 1 Score: 51.9878 bits (123), Expect = 2.304e-7 Identity = 23/34 (67.65%), Postives = 27/34 (79.41%), Query Frame = 3 Query: 297 IKAQNNQYPLCVFDTDKADKLKQSLPPGLTVQDL 398 ++ Y LCVFD +KADKLKQSLPPGL+VQDL Sbjct: 36 VRCSRYLYTLCVFDQEKADKLKQSLPPGLSVQDL 69 The following BLAST results are available for this feature:
BLAST of Cicer_arietinum_v1_Contig1069 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide) Total hits: 2
Sequences
The
following sequences are available for this feature:
contig sequence >Cicer_arietinum_v1_Contig1069 ID=Cicer_arietinum_v1_Contig1069; Name=Cicer_arietinum_v1_Contig1069; organism=Cicer arietinum; type=contig; length=534bpback to top |