Cicer_arietinum_v1_Contig1926
Contig Overview
Alignments
The following features are aligned
Unigenes
This contig is part of the following unigenes:
Analyses
This contig is derived from or has results from the following analyses
Relationships
The following EST feature(s) are a part of this contig:
Homology
BLAST of Cicer_arietinum_v1_Contig1926 vs. TrEMBL
Match: B1PIF3_9CONI (Putative senescence-associated protein (Fragment) OS=Cupressus sempervirens PE=2 SV=1) HSP 1 Score: 54.6842 bits (130), Expect = 1.128e-8 Identity = 29/46 (63.04%), Postives = 31/46 (67.39%), Query Frame = -2 Query: 405 ELNYYCDDKMKIFSIHQ*GKTNLPHDGLNPAHVPY*RGNNQTLGEF 542 +LNYY + HQ GKTNL HDGLNPAHVPY NN TLGEF Sbjct: 2 KLNYYRG------ADHQQGKTNLSHDGLNPAHVPYWWVNNPTLGEF 41 HSP 2 Score: 29.6462 bits (65), Expect = 1.128e-8 Identity = 17/38 (44.74%), Postives = 20/38 (52.63%), Query Frame = -3 Query: 299 GNSCFTMIGRSNFEEIKRNVP*KNLAAQTNLNPSGNLS 412 G CFTMIGR++ E K NV Q + P GN S Sbjct: 39 GEFCFTMIGRADIEGSKSNVAMNAWLPQASY-PCGNFS 75
BLAST of Cicer_arietinum_v1_Contig1926 vs. TrEMBL
Match: Q9AVH2_PEA (Putative senescence-associated protein (Fragment) OS=Pisum sativum GN=ssa-13 PE=2 SV=1) HSP 1 Score: 53.5286 bits (127), Expect = 2.212e-8 Identity = 28/37 (75.68%), Postives = 29/37 (78.38%), Query Frame = -1 Query: 523 SHIPTDGSFASLAFQLNAFTNYLNQRFLSY*VELLLR 633 SH PT GSFA LAFQ +A TN NQRFLSY VELLLR Sbjct: 18 SHNPTHGSFAPLAFQPSAMTNCANQRFLSYYVELLLR 54 HSP 2 Score: 29.6462 bits (65), Expect = 2.212e-8 Identity = 17/38 (44.74%), Postives = 20/38 (52.63%), Query Frame = -3 Query: 299 GNSCFTMIGRSNFEEIKRNVP*KNLAAQTNLNPSGNLS 412 G CFTMIGR++ E K NV Q + P GN S Sbjct: 85 GEFCFTMIGRADIEGSKSNVAMNAWLPQASY-PCGNFS 121
BLAST of Cicer_arietinum_v1_Contig1926 vs. TrEMBL
Match: C1NAM8_MICPS (Predicted protein (Fragment) OS=Micromonas pusilla CCMP1545 GN=MICPUCDRAFT_23888 PE=4 SV=1) HSP 1 Score: 40.817 bits (94), Expect = 5.640e-7 Identity = 21/33 (63.64%), Postives = 22/33 (66.67%), Query Frame = 3 Query: 531 VIQLSTRGTVDSDNW*MHLAEKLVMRSYHL*EY 629 VIQ STRGTVDS NW L EK V RSY +Y Sbjct: 22 VIQPSTRGTVDSHNWSSRLVEKPVARSYRALDY 54 HSP 2 Score: 37.7354 bits (86), Expect = 5.640e-7 Identity = 16/19 (84.21%), Postives = 17/19 (89.47%), Query Frame = 2 Query: 416 VFDCSPSNMERELGLDRRE 472 V DCSP+N ERELGLDRRE Sbjct: 2 VLDCSPTNRERELGLDRRE 20
BLAST of Cicer_arietinum_v1_Contig1926 vs. TrEMBL
Match: A8DWN7_NEMVE (Predicted protein (Fragment) OS=Nematostella vectensis GN=v1g157504 PE=4 SV=1) HSP 1 Score: 40.0466 bits (92), Expect = 9.497e-7 Identity = 18/22 (81.82%), Postives = 19/22 (86.36%), Query Frame = 3 Query: 531 VIQLSTRGTVDSDNW*MHLAEK 596 VI LSTRGT DSDNW +HLAEK Sbjct: 22 VILLSTRGTADSDNWHLHLAEK 43 HSP 2 Score: 37.7354 bits (86), Expect = 9.497e-7 Identity = 16/19 (84.21%), Postives = 17/19 (89.47%), Query Frame = 2 Query: 416 VFDCSPSNMERELGLDRRE 472 V DCSP+N ERELGLDRRE Sbjct: 2 VLDCSPTNRERELGLDRRE 20 The following BLAST results are available for this feature:
BLAST of Cicer_arietinum_v1_Contig1926 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 4
Sequences
The
following sequences are available for this feature:
contig sequence >Cicer_arietinum_v1_Contig1926 ID=Cicer_arietinum_v1_Contig1926; Name=Cicer_arietinum_v1_Contig1926; organism=Cicer arietinum; type=contig; length=699bpback to top |