Cicer_arietinum_v1_Contig2048
Contig Overview
Alignments
The following features are aligned
Unigenes
This contig is part of the following unigenes:
Analyses
This contig is derived from or has results from the following analyses
Relationships
The following EST feature(s) are a part of this contig:
Homology
BLAST of Cicer_arietinum_v1_Contig2048 vs. SwissProt
Match: RT14_OENBE (Ribosomal protein S14, mitochondrial OS=Oenothera bertiana GN=RPS14 PE=3 SV=2) HSP 1 Score: 69.3218 bits (168), Expect = 9.808e-12 Identity = 33/34 (97.06%), Postives = 33/34 (97.06%), Query Frame = 2 Query: 2 GRPRSVYEFFRISRIVFRGLASRGSLMGIKKSSW 103 GRPRSVYEFFRISRIVFRGLASRG LMGIKKSSW Sbjct: 66 GRPRSVYEFFRISRIVFRGLASRGPLMGIKKSSW 99
BLAST of Cicer_arietinum_v1_Contig2048 vs. SwissProt
Match: RT14_BRANA (Ribosomal protein S14, mitochondrial OS=Brassica napus GN=RPS14 PE=3 SV=1) HSP 1 Score: 65.4698 bits (158), Expect = 1.416e-10 Identity = 32/34 (94.12%), Postives = 32/34 (94.12%), Query Frame = 2 Query: 2 GRPRSVYEFFRISRIVFRGLASRGSLMGIKKSSW 103 GRPRSV EFFRI RIVFRGLASRGSLMGIKKSSW Sbjct: 67 GRPRSVSEFFRIYRIVFRGLASRGSLMGIKKSSW 100
BLAST of Cicer_arietinum_v1_Contig2048 vs. SwissProt
Match: RT14_VICFA (Ribosomal protein S14, mitochondrial OS=Vicia faba GN=RPS14 PE=3 SV=2) HSP 1 Score: 64.6994 bits (156), Expect = 2.416e-10 Identity = 31/34 (91.18%), Postives = 31/34 (91.18%), Query Frame = 2 Query: 2 GRPRSVYEFFRISRIVFRGLASRGSLMGIKKSSW 103 GRPRSVYE FRISRIVFR LASRG LMGIKKSSW Sbjct: 67 GRPRSVYELFRISRIVFRSLASRGPLMGIKKSSW 100
BLAST of Cicer_arietinum_v1_Contig2048 vs. SwissProt
Match: RT14_MARPO (Ribosomal protein S14, mitochondrial OS=Marchantia polymorpha GN=RPS14 PE=3 SV=2) HSP 1 Score: 57.7658 bits (138), Expect = 2.953e-8 Identity = 27/34 (79.41%), Postives = 30/34 (88.24%), Query Frame = 2 Query: 2 GRPRSVYEFFRISRIVFRGLASRGSLMGIKKSSW 103 GRPRSVY+ FRISRIVFR LAS+GSL+GI KS W Sbjct: 66 GRPRSVYKLFRISRIVFRELASKGSLIGINKSCW 99
BLAST of Cicer_arietinum_v1_Contig2048 vs. TrEMBL
Match: Q0QG47_JUNEF (Ribosomal protein S14 OS=Juncus effusus PE=4 SV=1) HSP 1 Score: 71.2478 bits (173), Expect = 3.651e-11 Identity = 34/34 (100.00%), Postives = 34/34 (100.00%), Query Frame = 2 Query: 2 GRPRSVYEFFRISRIVFRGLASRGSLMGIKKSSW 103 GRPRSVYEFFRISRIVFRGLASRGSLMGIKKSSW Sbjct: 67 GRPRSVYEFFRISRIVFRGLASRGSLMGIKKSSW 100
BLAST of Cicer_arietinum_v1_Contig2048 vs. TrEMBL
Match: Q0QG46_9POAL (Ribosomal protein S14 OS=Luzula sylvatica PE=4 SV=1) HSP 1 Score: 71.2478 bits (173), Expect = 3.651e-11 Identity = 34/34 (100.00%), Postives = 34/34 (100.00%), Query Frame = 2 Query: 2 GRPRSVYEFFRISRIVFRGLASRGSLMGIKKSSW 103 GRPRSVYEFFRISRIVFRGLASRGSLMGIKKSSW Sbjct: 67 GRPRSVYEFFRISRIVFRGLASRGSLMGIKKSSW 100
BLAST of Cicer_arietinum_v1_Contig2048 vs. TrEMBL
Match: Q9ZZT9_PEA (Ribosomal protein S14 OS=Pisum sativum GN=rps14 PE=4 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 1.387e-10 Identity = 33/34 (97.06%), Postives = 33/34 (97.06%), Query Frame = 2 Query: 2 GRPRSVYEFFRISRIVFRGLASRGSLMGIKKSSW 103 GRPRSVYEFFRISRIVFRGLASRG LMGIKKSSW Sbjct: 67 GRPRSVYEFFRISRIVFRGLASRGPLMGIKKSSW 100
BLAST of Cicer_arietinum_v1_Contig2048 vs. TrEMBL
Match: B9U3N2_CARPA (Ribosomal protein S14 OS=Carica papaya GN=rps14 PE=4 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 1.387e-10 Identity = 33/34 (97.06%), Postives = 33/34 (97.06%), Query Frame = 2 Query: 2 GRPRSVYEFFRISRIVFRGLASRGSLMGIKKSSW 103 GRPRSVYEFFRISRIVFRGLASRG LMGIKKSSW Sbjct: 67 GRPRSVYEFFRISRIVFRGLASRGPLMGIKKSSW 100
BLAST of Cicer_arietinum_v1_Contig2048 vs. TrEMBL
Match: B6VJT6_VITVI (Ribosomal protein S14 OS=Vitis vinifera GN=rps14 PE=4 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 1.387e-10 Identity = 33/34 (97.06%), Postives = 33/34 (97.06%), Query Frame = 2 Query: 2 GRPRSVYEFFRISRIVFRGLASRGSLMGIKKSSW 103 GRPRSVYEFFRISRIVFRGLASRG LMGIKKSSW Sbjct: 85 GRPRSVYEFFRISRIVFRGLASRGPLMGIKKSSW 118
BLAST of Cicer_arietinum_v1_Contig2048 vs. TrEMBL
Match: Q5MA48_TOBAC (Ribosomal protein S14 OS=Nicotiana tabacum GN=rps14 PE=4 SV=1) HSP 1 Score: 67.0106 bits (162), Expect = 3.549e-10 Identity = 33/43 (76.74%), Postives = 35/43 (81.40%), Query Frame = 1 Query: 34 NFSYRFSWISISRFFDGHKEIVLVATAKPIKQGLALHKEAKAG 162 NFSY FSWISISR FDGHKEIVLVAT KPI+QGLA + K G Sbjct: 76 NFSYPFSWISISRSFDGHKEIVLVATTKPIEQGLAPQQVYKQG 118 HSP 2 Score: 21.1718 bits (43), Expect = 3.549e-10 Identity = 8/8 (100.00%), Postives = 8/8 (100.00%), Query Frame = 2 Query: 2 GRPRSVYE 25 GRPRSVYE Sbjct: 67 GRPRSVYE 74
BLAST of Cicer_arietinum_v1_Contig2048 vs. TrEMBL
Match: Q0QG48_9POAL (Ribosomal protein S14 (Fragment) OS=Guzmania lingulata PE=4 SV=1) HSP 1 Score: 66.2402 bits (160), Expect = 1.174e-9 Identity = 32/34 (94.12%), Postives = 32/34 (94.12%), Query Frame = 2 Query: 2 GRPRSVYEFFRISRIVFRGLASRGSLMGIKKSSW 103 GRPRSV EFFRISRIVFRGLASRG LMGIKKSSW Sbjct: 59 GRPRSVVEFFRISRIVFRGLASRGPLMGIKKSSW 92
BLAST of Cicer_arietinum_v1_Contig2048 vs. TrEMBL
Match: Q0QG45_9POAL (Ribosomal protein S14 (Fragment) OS=Flagellaria indica PE=4 SV=1) HSP 1 Score: 66.2402 bits (160), Expect = 1.174e-9 Identity = 32/34 (94.12%), Postives = 32/34 (94.12%), Query Frame = 2 Query: 2 GRPRSVYEFFRISRIVFRGLASRGSLMGIKKSSW 103 GRPRSV EFFRISRIVFRGLASRG LMGIKKSSW Sbjct: 60 GRPRSVVEFFRISRIVFRGLASRGPLMGIKKSSW 93
BLAST of Cicer_arietinum_v1_Contig2048 vs. TrEMBL
Match: Q6YSL8_BRANA (Ribosomal protein S14 OS=Brassica napus GN=rps14 PE=4 SV=1) HSP 1 Score: 65.4698 bits (158), Expect = 2.003e-9 Identity = 32/34 (94.12%), Postives = 32/34 (94.12%), Query Frame = 2 Query: 2 GRPRSVYEFFRISRIVFRGLASRGSLMGIKKSSW 103 GRPRSV EFFRI RIVFRGLASRGSLMGIKKSSW Sbjct: 67 GRPRSVSEFFRIYRIVFRGLASRGSLMGIKKSSW 100
BLAST of Cicer_arietinum_v1_Contig2048 vs. TrEMBL
Match: Q0QG49_TYPLA (Ribosomal protein S14 (Fragment) OS=Typha latifolia PE=4 SV=1) HSP 1 Score: 65.0846 bits (157), Expect = 2.616e-9 Identity = 32/34 (94.12%), Postives = 32/34 (94.12%), Query Frame = 2 Query: 2 GRPRSVYEFFRISRIVFRGLASRGSLMGIKKSSW 103 GRPRSV EFFRISRIVFR LASRGSLMGIKKSSW Sbjct: 65 GRPRSVVEFFRISRIVFRELASRGSLMGIKKSSW 98
BLAST of Cicer_arietinum_v1_Contig2048 vs. TAIR peptide
Match: AT2G34520.1 (| Symbols: RPS14 | mitochondrial ribosomal protein S14 | chr2:14548218-14548712 REVERSE LENGTH=164) HSP 1 Score: 57.3806 bits (137), Expect = 4.388e-9 Identity = 27/34 (79.41%), Postives = 30/34 (88.24%), Query Frame = 2 Query: 2 GRPRSVYEFFRISRIVFRGLASRGSLMGIKKSSW 103 GR RSV E FR+SRIVFRGLAS+G+LMGI KSSW Sbjct: 131 GRSRSVTELFRVSRIVFRGLASKGALMGITKSSW 164 The following BLAST results are available for this feature:
BLAST of Cicer_arietinum_v1_Contig2048 vs. SwissProt
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Swissprot) Total hits: 4
BLAST of Cicer_arietinum_v1_Contig2048 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 10
BLAST of Cicer_arietinum_v1_Contig2048 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide) Total hits: 1
InterPro
Analysis Name: InterProScan analysis for Cicer arietinum unigene v1
Date Performed: 2010-12-29
Sequences
The
following sequences are available for this feature:
contig sequence >Cicer_arietinum_v1_Contig2048 ID=Cicer_arietinum_v1_Contig2048; Name=Cicer_arietinum_v1_Contig2048; organism=Cicer arietinum; type=contig; length=477bpback to top |