Cicer_arietinum_v1_Contig3725
Contig Overview
Alignments
The following features are aligned
Unigenes
This contig is part of the following unigenes:
Analyses
This contig is derived from or has results from the following analyses
Relationships
The following EST feature(s) are a part of this contig:
Homology
BLAST of Cicer_arietinum_v1_Contig3725 vs. TrEMBL
Match: B9RP47_RICCO (Grr1, plant, putative OS=Ricinus communis GN=RCOM_0924020 PE=4 SV=1) HSP 1 Score: 62.3882 bits (150), Expect = 1.712e-8 Identity = 28/44 (63.64%), Postives = 34/44 (77.27%), Query Frame = 2 Query: 233 MSQVFGFSGDN-FCPSGSIYTNPKEASFFPSLGHQVDAYFPPQR 361 MS++ GF+GD+ FCP GSIYTNPKE F SLGH VD YFP ++ Sbjct: 1 MSKLCGFAGDDDFCPGGSIYTNPKELGLFLSLGHHVDVYFPSRK 44
BLAST of Cicer_arietinum_v1_Contig3725 vs. TrEMBL
Match: B9HA53_POPTR (Ein3-binding f-box protein 3 OS=Populus trichocarpa GN=EBF3 PE=4 SV=1) HSP 1 Score: 57.7658 bits (138), Expect = 4.217e-7 Identity = 26/44 (59.09%), Postives = 33/44 (75.00%), Query Frame = 2 Query: 233 MSQVFGFSGDN-FCPSGSIYTNPKEASFFPSLGHQVDAYFPPQR 361 MS+VFGF+G+N FCP G IYTN KE + F S+G VD YFP ++ Sbjct: 1 MSKVFGFAGENDFCPGGPIYTNHKEQNLFLSIGRPVDVYFPSRK 44
BLAST of Cicer_arietinum_v1_Contig3725 vs. TAIR peptide
Match: AT2G25490.1 (| Symbols: EBF1, FBL6 | EIN3-binding F box protein 1 | chr2:10848018-10850275 REVERSE LENGTH=628) HSP 1 Score: 50.8322 bits (120), Expect = 2.881e-7 Identity = 24/44 (54.55%), Postives = 30/44 (68.18%), Query Frame = 2 Query: 233 MSQVFGFSGDN-FCPSGSIYTNPKEASFFPSLGHQVDAYFPPQR 361 MSQ+F F+G+N F G+IY NPK+AS SLG D YFPP + Sbjct: 1 MSQIFSFAGENDFYRRGAIYPNPKDASLLLSLGSFADVYFPPSK 44 The following BLAST results are available for this feature:
BLAST of Cicer_arietinum_v1_Contig3725 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 2
BLAST of Cicer_arietinum_v1_Contig3725 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide) Total hits: 1
InterPro
Analysis Name: InterProScan analysis for Cicer arietinum unigene v1
Date Performed: 2010-12-29
Sequences
The
following sequences are available for this feature:
contig sequence >Cicer_arietinum_v1_Contig3725 ID=Cicer_arietinum_v1_Contig3725; Name=Cicer_arietinum_v1_Contig3725; organism=Cicer arietinum; type=contig; length=410bpback to top |