Cicer_arietinum_v1_Contig421
Contig Overview
Alignments
The following features are aligned
Unigenes
This contig is part of the following unigenes:
Analyses
This contig is derived from or has results from the following analyses
Relationships
The following EST feature(s) are a part of this contig:
Homology
BLAST of Cicer_arietinum_v1_Contig421 vs. TrEMBL
Match: B9RMP7_RICCO (Two-component sensor histidine kinase bacteria, putative OS=Ricinus communis GN=RCOM_1082510 PE=4 SV=1) HSP 1 Score: 78.9518 bits (193), Expect = 3.100e-13 Identity = 45/111 (40.54%), Postives = 62/111 (55.86%), Query Frame = 2 Query: 5 QPISTSNFGLKTQSSNLGCIPDLESYQRSLLLVGEAASAPLDEDLYFYW-----HNMNFGQSNIGMSEYYDPGLLTEVPTHLYDS-------------TDYSVIDQGLFIA 283 +P TS +K Q N CI D+ES Q+S+ +PLD+D W + MN G+ NI + E YDPGL+ +VPTHLYD+ T+YS+++QGLFIA Sbjct: 478 EPNCTSTSTIKNQGFNPNCISDVESAQKSV----NWGMSPLDDDFQVCWFQGDYYAMNVGRQNIELPENYDPGLIADVPTHLYDAVRFDCDSTLLYDLTEYSLVEQGLFIA 584
BLAST of Cicer_arietinum_v1_Contig421 vs. TrEMBL
Match: D7TAK2_VITVI (Whole genome shotgun sequence of line PN40024, scaffold_10.assembly12x (Fragment) OS=Vitis vinifera GN=VIT_00010300001 PE=4 SV=1) HSP 1 Score: 73.1738 bits (178), Expect = 1.701e-11 Identity = 44/109 (40.37%), Postives = 60/109 (55.05%), Query Frame = 2 Query: 5 QPISTSNFGLKTQSSNLGCIPDLESYQRSLLLVGEAASAPLDEDLYFYW-----HNMNFGQSNIGMSEYYDPGLLTEVPTHLYDS-----------TDYSVIDQGLFIA 283 +PIS ++ Q N + DLES+QR+L+ +A L EDL +W + MN G NI S+Y+D L+TEVP HLYD T+Y ++DQGLFIA Sbjct: 487 EPISNITLNMRNQGHNQSGVNDLESFQRNLISGSGSALESL-EDLQVHWLQGDCNPMNLGLRNIEFSDYHDQKLITEVPFHLYDPLKLDYEYLSDLTEYPIMDQGLFIA 594
BLAST of Cicer_arietinum_v1_Contig421 vs. TrEMBL
Match: D7GN48_POPCA (Putative B-type response regulator 21 OS=Populus canadensis GN=rr21 PE=2 SV=1) HSP 1 Score: 72.4034 bits (176), Expect = 2.901e-11 Identity = 42/102 (41.18%), Postives = 60/102 (58.82%), Query Frame = 2 Query: 17 TSNFGLKTQSSNLGCIPDLESYQRSLLLVGEAASAPLDEDLYFYW----HNMNFGQSNIGMSEYYDPGLLTEVPTHL----------YDSTDYSVIDQGLFI 280 +S ++ Q N+ C+ D+ES ++++ L G APLDEDL + + M+ G NI + EY+DP LLT+VP HL YD T+YS+IDQ LFI Sbjct: 463 SSTSSMENQGLNMNCLTDVESSRKNINL-GMPPFAPLDEDLQVRFVPGDYYMSLGLQNIEVPEYFDPSLLTDVPIHLNDGLRFDYEFYDPTEYSLIDQSLFI 563
BLAST of Cicer_arietinum_v1_Contig421 vs. TrEMBL
Match: D7GN50_POPCA (Putative B-type response regulator 14 OS=Populus canadensis GN=rr14 PE=2 SV=1) HSP 1 Score: 65.0846 bits (157), Expect = 4.632e-9 Identity = 43/105 (40.95%), Postives = 57/105 (54.29%), Query Frame = 2 Query: 11 ISTSNFGLKTQSSNLGCIPDLESYQRSLLLVGEAASAPLDEDLYFYWHN----MNFGQSNIGMSEYYDPGLLTEVPTHLYDS----------TDYSVIDQGLFIA 283 IS S L+ Q N+ I + ES ++++ L G L+EDL W MN G NI + EY+DPGLLT+VP +L D T+YS+IDQ LFIA Sbjct: 491 ISKSTPSLENQGFNMNSITEFESSRKNINL-GMLPFTTLEEDLRVCWVPGDCYMNLGLQNIEVLEYFDPGLLTDVPVNLNDGLRFDYEFNDPTEYSLIDQSLFIA 594
BLAST of Cicer_arietinum_v1_Contig421 vs. TrEMBL
Match: B9HLB7_POPTR (Type-b response regulator OS=Populus trichocarpa GN=PtRR14 PE=4 SV=1) HSP 1 Score: 64.6994 bits (156), Expect = 6.050e-9 Identity = 42/105 (40.00%), Postives = 57/105 (54.29%), Query Frame = 2 Query: 11 ISTSNFGLKTQSSNLGCIPDLESYQRSLLLVGEAASAPLDEDLYFYWHN----MNFGQSNIGMSEYYDPGLLTEVPTHLYDS----------TDYSVIDQGLFIA 283 IS S L+ Q N+ I + ES ++++ L G L+EDL W MN G NI + EY+DPGL+T+VP +L D T+YS+IDQ LFIA Sbjct: 539 ISKSTPSLENQGFNMNSITEFESSRKNINL-GMLPFTTLEEDLQVCWVPGDCYMNLGLQNIEVLEYFDPGLITDVPVNLNDGLRFDYEFNDPTEYSLIDQSLFIA 642 The following BLAST results are available for this feature:
BLAST of Cicer_arietinum_v1_Contig421 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 5
Sequences
The
following sequences are available for this feature:
contig sequence >Cicer_arietinum_v1_Contig421 ID=Cicer_arietinum_v1_Contig421; Name=Cicer_arietinum_v1_Contig421; organism=Cicer arietinum; type=contig; length=612bpback to top |