FE672813
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of FE672813 vs. SwissProt
Match: NLTP_CICAR (Non-specific lipid-transfer protein OS=Cicer arietinum PE=3 SV=1) HSP 1 Score: 71.633 bits (174), Expect = 1.394e-12 Identity = 35/44 (79.55%), Postives = 37/44 (84.09%), Query Frame = 2 Query: 65 MANKKVVCVTPIMCIVIAPMAESAITCGRLSAALAQCLVYLQGG 196 MA+ KVVCV IMCIVIAPMAESAITCGR+ ALA CL YLQGG Sbjct: 1 MASMKVVCVALIMCIVIAPMAESAITCGRVDTALAPCLGYLQGG 44
BLAST of FE672813 vs. SwissProt
Match: NLTP1_LENCU (Non-specific lipid-transfer protein 1 OS=Lens culinaris PE=3 SV=1) HSP 1 Score: 54.6842 bits (130), Expect = 1.763e-7 Identity = 25/46 (54.35%), Postives = 35/46 (76.09%), Query Frame = 2 Query: 65 MANKKVVCVTPIMCIVI--APMAESAITCGRLSAALAQCLVYLQGG 196 MA+ +V C+ +MC+V+ APMAE+AI+CG +S AL CL YL+GG Sbjct: 1 MASLRVSCLVALMCMVVISAPMAEAAISCGTVSGALVPCLTYLKGG 46
BLAST of FE672813 vs. SwissProt
Match: NLTP5_LENCU (Non-specific lipid-transfer protein 5 OS=Lens culinaris PE=3 SV=1) HSP 1 Score: 53.5286 bits (127), Expect = 3.928e-7 Identity = 21/40 (52.50%), Postives = 30/40 (75.00%), Query Frame = 2 Query: 77 KVVCVTPIMCIVIAPMAESAITCGRLSAALAQCLVYLQGG 196 K+ CV +MC+++APMAE AI+CG ++ L+ CL YL GG Sbjct: 6 KLACVVLVMCMIVAPMAEGAISCGAVTGDLSPCLTYLTGG 45 The following BLAST results are available for this feature:
BLAST of FE672813 vs. SwissProt
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Swissprot) Total hits: 3
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >FE672813 ID=FE672813; Name=FE672813; organism=Cicer arietinum; type=EST; length=197bpback to top |