FE672914
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of FE672914 vs. TrEMBL
Match: C4J720_MAIZE (Putative uncharacterized protein OS=Zea mays PE=2 SV=1) HSP 1 Score: 67.3958 bits (163), Expect = 5.350e-10 Identity = 30/39 (76.92%), Postives = 34/39 (87.18%), Query Frame = -2 Query: 3 PFVPHEISDLAELMIGHLRYLATDVPPQPYSPHNSVFRP 119 PFVPHEIS L EL++GHLRYL TDVPPQP SP ++VFRP Sbjct: 65 PFVPHEISVLVELILGHLRYLLTDVPPQPNSPPDNVFRP 103
BLAST of FE672914 vs. TrEMBL
Match: B7FKH8_MEDTR (Putative uncharacterized protein OS=Medicago truncatula PE=2 SV=1) HSP 1 Score: 67.3958 bits (163), Expect = 5.350e-10 Identity = 30/39 (76.92%), Postives = 34/39 (87.18%), Query Frame = -2 Query: 3 PFVPHEISDLAELMIGHLRYLATDVPPQPYSPHNSVFRP 119 PFVPHEIS L EL++GHLRYL TDVPPQP SP ++VFRP Sbjct: 65 PFVPHEISVLVELILGHLRYLLTDVPPQPNSPPDNVFRP 103
BLAST of FE672914 vs. TrEMBL
Match: B2KZF9_PICAB (Senescence-associated protein OS=Picea abies GN=SAP1 PE=2 SV=1) HSP 1 Score: 67.3958 bits (163), Expect = 5.350e-10 Identity = 30/39 (76.92%), Postives = 34/39 (87.18%), Query Frame = -2 Query: 3 PFVPHEISDLAELMIGHLRYLATDVPPQPYSPHNSVFRP 119 PFVPHEIS L EL++GHLRYL TDVPPQP SP ++VFRP Sbjct: 65 PFVPHEISVLVELILGHLRYLLTDVPPQPNSPPDNVFRP 103
BLAST of FE672914 vs. TrEMBL
Match: B2BAK4_LILLO (Cytochrome P450-like TBP protein (Fragment) OS=Lilium longiflorum PE=2 SV=1) HSP 1 Score: 67.3958 bits (163), Expect = 5.350e-10 Identity = 30/39 (76.92%), Postives = 34/39 (87.18%), Query Frame = -2 Query: 3 PFVPHEISDLAELMIGHLRYLATDVPPQPYSPHNSVFRP 119 PFVPHEIS L EL++GHLRYL TDVPPQP SP ++VFRP Sbjct: 11 PFVPHEISVLVELILGHLRYLLTDVPPQPNSPPDNVFRP 49
BLAST of FE672914 vs. TrEMBL
Match: Q0WLP3_ARATH (Putative uncharacterized protein OS=Arabidopsis thaliana PE=2 SV=1) HSP 1 Score: 65.0846 bits (157), Expect = 2.655e-9 Identity = 29/39 (74.36%), Postives = 33/39 (84.62%), Query Frame = -2 Query: 3 PFVPHEISDLAELMIGHLRYLATDVPPQPYSPHNSVFRP 119 PFVPHEIS L EL++GHLRYL TDVPPQP SP ++V RP Sbjct: 65 PFVPHEISVLVELILGHLRYLLTDVPPQPNSPPDNVLRP 103
BLAST of FE672914 vs. TrEMBL
Match: C1NAM9_MICPS (Senescence-associated protein OS=Micromonas pusilla CCMP1545 GN=SSA13 PE=4 SV=1) HSP 1 Score: 65.0846 bits (157), Expect = 2.655e-9 Identity = 29/39 (74.36%), Postives = 33/39 (84.62%), Query Frame = -2 Query: 3 PFVPHEISDLAELMIGHLRYLATDVPPQPYSPHNSVFRP 119 PFVPHEIS L EL++GHLRYL TDVPPQP SP ++V RP Sbjct: 50 PFVPHEISVLVELILGHLRYLLTDVPPQPNSPPDNVLRP 88
BLAST of FE672914 vs. TrEMBL
Match: A9U7C8_PHYPA (Predicted protein (Fragment) OS=Physcomitrella patens subsp. patens GN=PHYPADRAFT_54736 PE=4 SV=1) HSP 1 Score: 62.7734 bits (151), Expect = 1.318e-8 Identity = 28/37 (75.68%), Postives = 32/37 (86.49%), Query Frame = -2 Query: 9 PFVPHEISDLAELMIGHLRYLATDVPPQPYSPHNSVF 119 PFVPHEIS L EL++GHLRYL TDVPPQP SP ++VF Sbjct: 46 PFVPHEISVLVELILGHLRYLLTDVPPQPNSPPDNVF 82
BLAST of FE672914 vs. TrEMBL
Match: A9U6L8_PHYPA (Predicted protein OS=Physcomitrella patens subsp. patens GN=PHYPADRAFT_157767 PE=4 SV=1) HSP 1 Score: 62.7734 bits (151), Expect = 1.318e-8 Identity = 28/37 (75.68%), Postives = 32/37 (86.49%), Query Frame = -2 Query: 9 PFVPHEISDLAELMIGHLRYLATDVPPQPYSPHNSVF 119 PFVPHEIS L EL++GHLRYL TDVPPQP SP ++VF Sbjct: 50 PFVPHEISVLVELILGHLRYLLTDVPPQPNSPPDNVF 86
BLAST of FE672914 vs. TrEMBL
Match: A9U5J7_PHYPA (Predicted protein (Fragment) OS=Physcomitrella patens subsp. patens GN=PHYPADRAFT_39517 PE=4 SV=1) HSP 1 Score: 62.7734 bits (151), Expect = 1.318e-8 Identity = 28/37 (75.68%), Postives = 32/37 (86.49%), Query Frame = -2 Query: 9 PFVPHEISDLAELMIGHLRYLATDVPPQPYSPHNSVF 119 PFVPHEIS L EL++GHLRYL TDVPPQP SP ++VF Sbjct: 15 PFVPHEISVLVELILGHLRYLLTDVPPQPNSPPDNVF 51
BLAST of FE672914 vs. TrEMBL
Match: A9TVA3_PHYPA (Predicted protein OS=Physcomitrella patens subsp. patens GN=PHYPADRAFT_151305 PE=4 SV=1) HSP 1 Score: 62.7734 bits (151), Expect = 1.318e-8 Identity = 28/37 (75.68%), Postives = 32/37 (86.49%), Query Frame = -2 Query: 9 PFVPHEISDLAELMIGHLRYLATDVPPQPYSPHNSVF 119 PFVPHEIS L EL++GHLRYL TDVPPQP SP ++VF Sbjct: 50 PFVPHEISVLVELILGHLRYLLTDVPPQPNSPPDNVF 86 The following BLAST results are available for this feature:
BLAST of FE672914 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 10
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >FE672914 ID=FE672914; Name=FE672914; organism=Cicer arietinum; type=EST; length=120bpback to top |