GR914802
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of GR914802 vs. TrEMBL
Match: Q0WYJ3_FUSOX (Putative pyruvate decarboxylase OS=Fusarium oxysporum f. sp. lycopersici GN=pdc1 PE=3 SV=1) HSP 1 Score: 73.559 bits (179), Expect = 7.320e-12 Identity = 35/38 (92.11%), Postives = 37/38 (97.37%), Query Frame = 3 Query: 24 YKDLVSVFGGEKTCKTFQIKTKTELNELLTDEEVNAAE 137 YKDLVSVFGGEKTCKTFQIKTKTELNELLT++E NAAE Sbjct: 500 YKDLVSVFGGEKTCKTFQIKTKTELNELLTNKEFNAAE 537
BLAST of GR914802 vs. TrEMBL
Match: C7YP39_NECH7 (Predicted protein OS=Nectria haematococca (strain 77-13-4 / FGSC 9596 / MPVI) GN=NECHADRAFT_99885 PE=3 SV=1) HSP 1 Score: 61.6178 bits (148), Expect = 2.879e-8 Identity = 29/37 (78.38%), Postives = 31/37 (83.78%), Query Frame = 3 Query: 24 YKDLVSVFGGEKTCKTFQIKTKTELNELLTDEEVNAA 134 YK+LV VFGGEKTCKTF IKTK ELN+LL DEE AA Sbjct: 503 YKELVRVFGGEKTCKTFTIKTKDELNDLLVDEEFKAA 539 The following BLAST results are available for this feature:
BLAST of GR914802 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 2
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >GR914802 ID=GR914802; Name=GR914802; organism=Cicer arietinum; type=EST; length=139bpback to top |