HO062963
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of HO062963 vs. TrEMBL
Match: Q9FUS7_ARATH (Glutathione S-transferase OS=Arabidopsis thaliana GN=GST30b PE=2 SV=1) HSP 1 Score: 56.225 bits (134), Expect = 9.237e-7 Identity = 26/42 (61.90%), Postives = 32/42 (76.19%), Query Frame = -3 Query: 118 LEEAKTPSLGKGAENFVNNPVVKRILPKTYKLFDFAKNFFQK 243 L+EAKTPSL K AENF N+P VK ++P+T KL +FAK F K Sbjct: 163 LDEAKTPSLSKWAENFCNDPAVKPVMPETAKLAEFAKKIFPK 204 HSP 2 Score: 20.7866 bits (42), Expect = 9.237e-7 Identity = 11/22 (50.00%), Postives = 11/22 (50.00%), Query Frame = -2 Query: 332 RHFLKKGRNASQLSGGKIFFGG 397 R FLK G S GK FF G Sbjct: 113 RGFLKAGGAFIDCSKGKPFFNG 134
BLAST of HO062963 vs. TAIR peptide
Match: AT1G10370.1 (| Symbols: GST30, ATGSTU17, GST30B, ERD9 | Glutathione S-transferase family protein | chr1:3397274-3398273 REVERSE LENGTH=227) HSP 1 Score: 56.225 bits (134), Expect = 1.409e-8 Identity = 26/42 (61.90%), Postives = 32/42 (76.19%), Query Frame = -3 Query: 118 LEEAKTPSLGKGAENFVNNPVVKRILPKTYKLFDFAKNFFQK 243 L+EAKTPSL K AENF N+P VK ++P+T KL +FAK F K Sbjct: 183 LDEAKTPSLSKWAENFCNDPAVKPVMPETAKLAEFAKKIFPK 224 The following BLAST results are available for this feature:
BLAST of HO062963 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 1
BLAST of HO062963 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide) Total hits: 1
InterPro
Analysis Name: InterProScan analysis for Cicer arietinum unigene v1
Date Performed: 2010-12-29
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >HO062963 ID=HO062963; Name=HO062963; organism=Cicer arietinum; type=EST; length=575bpback to top Annotated Terms
The
following terms have been associated with
this EST:
|