GR393407
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of GR393407 vs. SwissProt
Match: TAR1_YEAST (Protein TAR1 OS=Saccharomyces cerevisiae GN=TAR1 PE=2 SV=1) HSP 1 Score: 53.1434 bits (126), Expect = 6.625e-8 Identity = 25/34 (73.53%), Postives = 28/34 (82.35%), Query Frame = 3 Query: 3 FPHGTCLLSVSYQYLALNEIYHPIRAAIPSNSTL 104 F H TC LSVS QYLAL+ IYHP+RAA P+NSTL Sbjct: 41 FHHCTCSLSVSRQYLALDGIYHPLRAAFPNNSTL 74 HSP 2 Score: 22.7126 bits (47), Expect = 6.625e-8 Identity = 9/12 (75.00%), Postives = 9/12 (75.00%), Query Frame = 1 Query: 142 TGFSPSMIPCFK 177 TGFSPSM C K Sbjct: 87 TGFSPSMTSCSK 98
BLAST of GR393407 vs. SwissProt
Match: TAR1_KLULA (Protein TAR1 OS=Kluyveromyces lactis GN=TAR1-A PE=4 SV=2) HSP 1 Score: 51.6026 bits (122), Expect = 1.880e-7 Identity = 24/33 (72.73%), Postives = 27/33 (81.82%), Query Frame = 3 Query: 3 FPHGTCLLSVSYQYLALNEIYHPIRAAIPSNST 101 F H TC LSVS QYLAL+ IYHP+RAA P+NST Sbjct: 26 FHHCTCSLSVSRQYLALDGIYHPLRAAFPNNST 58 HSP 2 Score: 22.7126 bits (47), Expect = 1.880e-7 Identity = 9/12 (75.00%), Postives = 9/12 (75.00%), Query Frame = 1 Query: 142 TGFSPSMIPCFK 177 TGFSPSM C K Sbjct: 72 TGFSPSMTSCSK 83
BLAST of GR393407 vs. TrEMBL
Match: D7G500_ECTSI (Putative uncharacterized protein OS=Ectocarpus siliculosus GN=Esi_0595_0003 PE=4 SV=1) HSP 1 Score: 60.8474 bits (146), Expect = 5.078e-8 Identity = 28/34 (82.35%), Postives = 30/34 (88.24%), Query Frame = 2 Query: 2 FPSRYLFAIGLLPIFSFK*NLPPN*SCNPKQLDS 103 FPSRYLFAIGL P+FSF+ NLPP SCNPKQLDS Sbjct: 60 FPSRYLFAIGLPPVFSFRWNLPPALSCNPKQLDS 93 The following BLAST results are available for this feature:
BLAST of GR393407 vs. SwissProt
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Swissprot) Total hits: 2
BLAST of GR393407 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 1
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >GR393407 ID=GR393407; Name=GR393407; organism=Cicer arietinum; type=EST; length=179bpback to top |