FE668856
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of FE668856 vs. TrEMBL
Match: B9H8X2_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_762681 PE=4 SV=1) HSP 1 Score: 65.855 bits (159), Expect = 1.569e-9 Identity = 37/70 (52.86%), Postives = 52/70 (74.29%), Query Frame = 2 Query: 59 HHHQQLFRSPSVLQRLKSIDFYS-YPYRSQQEPLTQQLQTYENETPQLVRSPSVLQRLKSINLLNF-QFP 262 H +Q L R+PS+LQR+KSID++S Y + QEP Q T E++ PQL R+PS+LQR+KSI+ L+F +FP Sbjct: 43 HEYQHLARAPSLLQRVKSIDYFSFYNFPPAQEP---QNTTQEHDPPQLERAPSLLQRVKSIDYLSFYKFP 109 HSP 2 Score: 65.4698 bits (158), Expect = 2.049e-9 Identity = 37/77 (48.05%), Postives = 51/77 (66.23%), Query Frame = 2 Query: 32 QEAQNFPQPHHHQQLFRSPSVLQRLKSIDFYS-YPYRSQQEPLTQQLQTYENETPQLVRSPSVLQRLKSINLLNFQF 259 QE QN Q H QL R+PS+LQR+KSID+ S Y + QEP + T E++ PQL R+PS+L+R+KSIN + + Sbjct: 73 QEPQNTTQEHDPPQLERAPSLLQRVKSIDYLSFYKFPPAQEP---ENTTQEHDPPQLERAPSLLERVKSINFSSLYY 146
BLAST of FE668856 vs. TrEMBL
Match: B9RRS2_RICCO (Putative uncharacterized protein OS=Ricinus communis GN=RCOM_0797410 PE=4 SV=1) HSP 1 Score: 65.4698 bits (158), Expect = 2.049e-9 Identity = 43/98 (43.88%), Postives = 51/98 (52.04%), Query Frame = 2 Query: 62 HHQQLFRSPSVLQRLKSIDFYSY----------------------PYRSQQEPLTQQLQTYENETPQLVRSPSVLQRLKSINLLNFQFPIHRAFSSEL 289 HH Q+ RSPSVLQRLKSI+F+SY P+ QQ P L+ Y P L RSPS+LQR+KSINL N+ FS EL Sbjct: 57 HHHQIARSPSVLQRLKSINFHSYRSPEPTTVTLEKTHQFDNSSNTPFSFQQSP----LEEYHQNQPFLSRSPSMLQRIKSINLYNY-------FSQEL 143
BLAST of FE668856 vs. TrEMBL
Match: B9IKA6_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_577950 PE=4 SV=1) HSP 1 Score: 62.003 bits (149), Expect = 2.265e-8 Identity = 44/93 (47.31%), Postives = 52/93 (55.91%), Query Frame = 2 Query: 62 HHQQLFRSPSVLQRLKSIDFYSYPYRSQQEPLT---------------------QQLQTYENET-PQLVRSPSVLQRLKSINLLNF--QFPIH 268 H QL RSPSVLQRLKSI+FYSY QEP T Q Q ++N+ P + RSPS+LQRLKSINL N+ Q PI+ Sbjct: 66 HGHQLARSPSVLQRLKSINFYSY---RSQEPTTFTFEKPQESDQHFTLHQQTPQQGYQYHQNQNQPPISRSPSMLQRLKSINLYNYFSQEPIN 155
BLAST of FE668856 vs. TrEMBL
Match: A9PG59_POPTR (Putative uncharacterized protein OS=Populus trichocarpa PE=2 SV=1) HSP 1 Score: 62.003 bits (149), Expect = 2.265e-8 Identity = 44/93 (47.31%), Postives = 52/93 (55.91%), Query Frame = 2 Query: 62 HHQQLFRSPSVLQRLKSIDFYSYPYRSQQEPLT---------------------QQLQTYENET-PQLVRSPSVLQRLKSINLLNF--QFPIH 268 H QL RSPSVLQRLKSI+FYSY QEP T Q Q ++N+ P + RSPS+LQRLKSINL N+ Q PI+ Sbjct: 66 HGHQLARSPSVLQRLKSINFYSY---RSQEPTTFTFEKPQESDQHFTLHQQTPQQGYQYHQNQNQPPISRSPSMLQRLKSINLYNYFSQEPIN 155
BLAST of FE668856 vs. TAIR peptide
Match: AT5G56980.1 (| Symbols: | unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: endomembrane system; EXPRESSED IN: 18 plant structures; EXPRESSED DURING: 12 growth stages; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT4G26130.1); Has 30201 Blast hits to 17322 proteins in 780 species: Archae - 12; Bacteria - 1396; Metazoa - 17338; Fungi - 3422; Plants - 5037; Viruses - 0; Other Eukaryotes - 2996 (source: NCBI BLink). | chr5:23056574-23057713 REVERSE LENGTH=379) HSP 1 Score: 48.9062 bits (115), Expect = 7.564e-7 Identity = 29/88 (32.95%), Postives = 45/88 (51.14%), Query Frame = 2 Query: 32 QEAQNFPQPHHHQQLFRSPSVLQRLKSIDFYSYPY----------RSQQEPLTQQLQTYENETPQ-LVRSPSVLQRLKSINLLNFQFP 262 Q F H L R+PS++ R+KSI+F+ Y + + + + L Y + P L R+PS+L R+KSIN+ F+FP Sbjct: 42 QHHDGFGSGHAPAPLARAPSIIDRVKSINFHLYKFPHPETELFSMTAHHDIIGSDLHVYPDPNPAPLQRAPSLLDRVKSINMSYFKFP 129 The following BLAST results are available for this feature:
BLAST of FE668856 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 4
BLAST of FE668856 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide) Total hits: 1
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >FE668856 ID=FE668856; Name=FE668856; organism=Cicer arietinum; type=EST; length=305bpback to top |