GR407714
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of GR407714 vs. SwissProt
Match: CESA6_ARATH (Cellulose synthase A catalytic subunit 6 [UDP-forming] OS=Arabidopsis thaliana GN=CESA6 PE=1 SV=2) HSP 1 Score: 66.2402 bits (160), Expect = 5.824e-11 Identity = 31/36 (86.11%), Postives = 35/36 (97.22%), Query Frame = 3 Query: 225 MHTGGRLIAGSHNRNEFVLINAEENGRIKSVRELSG 332 M+TGGRLIAGSHNRNEFVLINA+EN RI+SV+ELSG Sbjct: 1 MNTGGRLIAGSHNRNEFVLINADENARIRSVQELSG 36
BLAST of GR407714 vs. SwissProt
Match: CESA2_ARATH (Cellulose synthase A catalytic subunit 2 [UDP-forming] OS=Arabidopsis thaliana GN=CESA2 PE=1 SV=1) HSP 1 Score: 64.3142 bits (155), Expect = 2.213e-10 Identity = 30/36 (83.33%), Postives = 35/36 (97.22%), Query Frame = 3 Query: 225 MHTGGRLIAGSHNRNEFVLINAEENGRIKSVRELSG 332 M+TGGRLIAGSHNRNEFVLINA+E+ RI+SV+ELSG Sbjct: 1 MNTGGRLIAGSHNRNEFVLINADESARIRSVQELSG 36
BLAST of GR407714 vs. SwissProt
Match: CESA5_ARATH (Cellulose synthase A catalytic subunit 5 [UDP-forming] OS=Arabidopsis thaliana GN=CESA5 PE=1 SV=2) HSP 1 Score: 63.929 bits (154), Expect = 2.891e-10 Identity = 30/36 (83.33%), Postives = 34/36 (94.44%), Query Frame = 3 Query: 225 MHTGGRLIAGSHNRNEFVLINAEENGRIKSVRELSG 332 M+TGGRLIAGSHNRNEFVLINA+E+ RI+SV ELSG Sbjct: 1 MNTGGRLIAGSHNRNEFVLINADESARIRSVEELSG 36
BLAST of GR407714 vs. SwissProt
Match: CESA9_ARATH (Probable cellulose synthase A catalytic subunit 9 [UDP-forming] OS=Arabidopsis thaliana GN=CESA9 PE=2 SV=1) HSP 1 Score: 60.8474 bits (146), Expect = 2.447e-9 Identity = 28/36 (77.78%), Postives = 32/36 (88.89%), Query Frame = 3 Query: 225 MHTGGRLIAGSHNRNEFVLINAEENGRIKSVRELSG 332 M+TGGRLIAGSHNRNEFVLINA++ RI+S ELSG Sbjct: 1 MNTGGRLIAGSHNRNEFVLINADDTARIRSAEELSG 36
BLAST of GR407714 vs. TrEMBL
Match: Q6YBV3_POPTM (Cellulose synthase OS=Populus tremuloides GN=CesA7 PE=2 SV=1) HSP 1 Score: 67.781 bits (164), Expect = 4.122e-10 Identity = 32/36 (88.89%), Postives = 35/36 (97.22%), Query Frame = 3 Query: 225 MHTGGRLIAGSHNRNEFVLINAEENGRIKSVRELSG 332 M+TGGRLIAGSHNRNEFVLINA+EN RIKSV+ELSG Sbjct: 1 MNTGGRLIAGSHNRNEFVLINADENARIKSVKELSG 36
BLAST of GR407714 vs. TrEMBL
Match: Q6J8W8_9ROSI (Cellulose synthase OS=Populus tremula x Populus tremuloides GN=CesA4 PE=2 SV=1) HSP 1 Score: 67.781 bits (164), Expect = 4.122e-10 Identity = 32/36 (88.89%), Postives = 35/36 (97.22%), Query Frame = 3 Query: 225 MHTGGRLIAGSHNRNEFVLINAEENGRIKSVRELSG 332 M+TGGRLIAGSHNRNEFVLINA+EN RIKSV+ELSG Sbjct: 1 MNTGGRLIAGSHNRNEFVLINADENARIKSVKELSG 36
BLAST of GR407714 vs. TrEMBL
Match: B9H5M9_POPTR (Putative uncharacterized protein OS=Populus trichocarpa GN=POPTRDRAFT_760228 PE=4 SV=1) HSP 1 Score: 67.781 bits (164), Expect = 4.122e-10 Identity = 32/36 (88.89%), Postives = 35/36 (97.22%), Query Frame = 3 Query: 225 MHTGGRLIAGSHNRNEFVLINAEENGRIKSVRELSG 332 M+TGGRLIAGSHNRNEFVLINA+EN RIKSV+ELSG Sbjct: 1 MNTGGRLIAGSHNRNEFVLINADENARIKSVKELSG 36
BLAST of GR407714 vs. TrEMBL
Match: B9HGD0_POPTR (Predicted protein (Fragment) OS=Populus trichocarpa GN=POPTRDRAFT_819877 PE=4 SV=1) HSP 1 Score: 67.3958 bits (163), Expect = 5.384e-10 Identity = 32/36 (88.89%), Postives = 35/36 (97.22%), Query Frame = 3 Query: 225 MHTGGRLIAGSHNRNEFVLINAEENGRIKSVRELSG 332 M+TGGRLIAGSHNRNEFVLINA+EN RIKSV+ELSG Sbjct: 1 MNTGGRLIAGSHNRNEFVLINADENARIKSVQELSG 36
BLAST of GR407714 vs. TrEMBL
Match: B9HGC9_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_819877 PE=4 SV=1) HSP 1 Score: 67.3958 bits (163), Expect = 5.384e-10 Identity = 32/36 (88.89%), Postives = 35/36 (97.22%), Query Frame = 3 Query: 225 MHTGGRLIAGSHNRNEFVLINAEENGRIKSVRELSG 332 M+TGGRLIAGSHNRNEFVLINA+EN RIKSV+ELSG Sbjct: 1 MNTGGRLIAGSHNRNEFVLINADENARIKSVQELSG 36
BLAST of GR407714 vs. TrEMBL
Match: D7MSJ2_ARALY (Putative uncharacterized protein OS=Arabidopsis lyrata subsp. lyrata GN=ARALYDRAFT_496689 PE=4 SV=1) HSP 1 Score: 66.2402 bits (160), Expect = 1.199e-9 Identity = 31/36 (86.11%), Postives = 35/36 (97.22%), Query Frame = 3 Query: 225 MHTGGRLIAGSHNRNEFVLINAEENGRIKSVRELSG 332 M+TGGRLIAGSHNRNEFVLINA+EN RI+SV+ELSG Sbjct: 1 MNTGGRLIAGSHNRNEFVLINADENARIRSVQELSG 36
BLAST of GR407714 vs. TrEMBL
Match: D7MGE1_ARALY (Putative uncharacterized protein OS=Arabidopsis lyrata subsp. lyrata GN=ARALYDRAFT_490712 PE=4 SV=1) HSP 1 Score: 64.3142 bits (155), Expect = 4.558e-9 Identity = 30/36 (83.33%), Postives = 35/36 (97.22%), Query Frame = 3 Query: 225 MHTGGRLIAGSHNRNEFVLINAEENGRIKSVRELSG 332 M+TGGRLIAGSHNRNEFVLINA+E+ RI+SV+ELSG Sbjct: 1 MNTGGRLIAGSHNRNEFVLINADESARIRSVQELSG 36
BLAST of GR407714 vs. TrEMBL
Match: D7M282_ARALY (Putative uncharacterized protein OS=Arabidopsis lyrata subsp. lyrata GN=ARALYDRAFT_908936 PE=4 SV=1) HSP 1 Score: 63.929 bits (154), Expect = 5.953e-9 Identity = 30/36 (83.33%), Postives = 34/36 (94.44%), Query Frame = 3 Query: 225 MHTGGRLIAGSHNRNEFVLINAEENGRIKSVRELSG 332 M+TGGRLIAGSHNRNEFVLINA+E+ RI+SV ELSG Sbjct: 1 MNTGGRLIAGSHNRNEFVLINADESARIRSVEELSG 36
BLAST of GR407714 vs. TrEMBL
Match: D7LBY5_ARALY (Putative uncharacterized protein OS=Arabidopsis lyrata subsp. lyrata GN=ARALYDRAFT_900606 PE=4 SV=1) HSP 1 Score: 63.929 bits (154), Expect = 5.953e-9 Identity = 30/36 (83.33%), Postives = 34/36 (94.44%), Query Frame = 3 Query: 225 MHTGGRLIAGSHNRNEFVLINAEENGRIKSVRELSG 332 M+TGGRLIAGSHNRNEFVLINA+E RI+SV+ELSG Sbjct: 1 MNTGGRLIAGSHNRNEFVLINADETARIRSVQELSG 36
BLAST of GR407714 vs. TrEMBL
Match: D7SWA6_VITVI (Whole genome shotgun sequence of line PN40024, scaffold_31.assembly12x (Fragment) OS=Vitis vinifera GN=VIT_00022285001 PE=4 SV=1) HSP 1 Score: 60.8474 bits (146), Expect = 5.039e-8 Identity = 29/36 (80.56%), Postives = 33/36 (91.67%), Query Frame = 3 Query: 225 MHTGGRLIAGSHNRNEFVLINAEENGRIKSVRELSG 332 M TGGRL+AGSH+RNEFVLINA++ RIKSVRELSG Sbjct: 1 MATGGRLVAGSHHRNEFVLINADDIARIKSVRELSG 36
BLAST of GR407714 vs. TAIR peptide
Match: AT5G64740.1 (| Symbols: CESA6, IXR2, E112, PRC1 | cellulose synthase 6 | chr5:25881555-25886333 FORWARD LENGTH=1084) HSP 1 Score: 66.2402 bits (160), Expect = 4.619e-12 Identity = 31/36 (86.11%), Postives = 35/36 (97.22%), Query Frame = 3 Query: 225 MHTGGRLIAGSHNRNEFVLINAEENGRIKSVRELSG 332 M+TGGRLIAGSHNRNEFVLINA+EN RI+SV+ELSG Sbjct: 1 MNTGGRLIAGSHNRNEFVLINADENARIRSVQELSG 36
BLAST of GR407714 vs. TAIR peptide
Match: AT4G39350.1 (| Symbols: CESA2, ATH-A, ATCESA2 | cellulose synthase A2 | chr4:18297078-18301890 FORWARD LENGTH=1084) HSP 1 Score: 64.3142 bits (155), Expect = 1.755e-11 Identity = 30/36 (83.33%), Postives = 35/36 (97.22%), Query Frame = 3 Query: 225 MHTGGRLIAGSHNRNEFVLINAEENGRIKSVRELSG 332 M+TGGRLIAGSHNRNEFVLINA+E+ RI+SV+ELSG Sbjct: 1 MNTGGRLIAGSHNRNEFVLINADESARIRSVQELSG 36
BLAST of GR407714 vs. TAIR peptide
Match: AT5G09870.1 (| Symbols: CESA5 | cellulose synthase 5 | chr5:3073356-3077974 FORWARD LENGTH=1069) HSP 1 Score: 63.929 bits (154), Expect = 2.292e-11 Identity = 30/36 (83.33%), Postives = 34/36 (94.44%), Query Frame = 3 Query: 225 MHTGGRLIAGSHNRNEFVLINAEENGRIKSVRELSG 332 M+TGGRLIAGSHNRNEFVLINA+E+ RI+SV ELSG Sbjct: 1 MNTGGRLIAGSHNRNEFVLINADESARIRSVEELSG 36
BLAST of GR407714 vs. TAIR peptide
Match: AT2G21770.1 (| Symbols: CESA9, CESA09 | cellulose synthase A9 | chr2:9284837-9289495 FORWARD LENGTH=1088) HSP 1 Score: 60.8474 bits (146), Expect = 1.941e-10 Identity = 28/36 (77.78%), Postives = 32/36 (88.89%), Query Frame = 3 Query: 225 MHTGGRLIAGSHNRNEFVLINAEENGRIKSVRELSG 332 M+TGGRLIAGSHNRNEFVLINA++ RI+S ELSG Sbjct: 1 MNTGGRLIAGSHNRNEFVLINADDTARIRSAEELSG 36 The following BLAST results are available for this feature:
BLAST of GR407714 vs. SwissProt
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Swissprot) Total hits: 4
BLAST of GR407714 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 10
BLAST of GR407714 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide) Total hits: 4
InterPro
Analysis Name: InterProScan analysis for Cicer arietinum unigene v1
Date Performed: 2010-12-29
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >GR407714 ID=GR407714; Name=GR407714; organism=Cicer arietinum; type=EST; length=334bpback to top |