GR912908
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of GR912908 vs. TrEMBL
Match: D3YBB1_TRIRP (Calcium ATPase OS=Trifolium repens PE=3 SV=1) HSP 1 Score: 65.4698 bits (158), Expect = 2.000e-9 Identity = 31/32 (96.88%), Postives = 32/32 (100.00%), Query Frame = 1 Query: 28 SPLSLKLWFVSVFLGVLGMPIGAALKMIPVGS 123 SPLSLKLWFVSVFLGVLGMPIGAA+KMIPVGS Sbjct: 987 SPLSLKLWFVSVFLGVLGMPIGAAIKMIPVGS 1018
BLAST of GR912908 vs. TrEMBL
Match: Q8H1L4_MEDTR (Type IIB calcium ATPase (Fragment) OS=Medicago truncatula GN=MCA6 PE=2 SV=1) HSP 1 Score: 63.5438 bits (153), Expect = 7.601e-9 Identity = 30/32 (93.75%), Postives = 31/32 (96.88%), Query Frame = 1 Query: 28 SPLSLKLWFVSVFLGVLGMPIGAALKMIPVGS 123 SPLSLKLW +SVFLGVLGMPIGAALKMIPVGS Sbjct: 505 SPLSLKLWLISVFLGVLGMPIGAALKMIPVGS 536
BLAST of GR912908 vs. TAIR peptide
Match: AT1G27770.2 (| Symbols: ACA1, PEA1 | autoinhibited Ca2+-ATPase 1 | chr1:9671912-9676010 REVERSE LENGTH=946) HSP 1 Score: 49.2914 bits (116), Expect = 5.843e-7 Identity = 22/32 (68.75%), Postives = 26/32 (81.25%), Query Frame = 1 Query: 28 SPLSLKLWFVSVFLGVLGMPIGAALKMIPVGS 123 +PL+L W VS+ LG LGMP+ AALKMIPVGS Sbjct: 914 TPLNLGQWLVSIILGFLGMPVAAALKMIPVGS 945
BLAST of GR912908 vs. TAIR peptide
Match: AT1G27770.1 (| Symbols: ACA1, PEA1 | autoinhibited Ca2+-ATPase 1 | chr1:9671912-9676010 REVERSE LENGTH=1020) HSP 1 Score: 49.2914 bits (116), Expect = 5.843e-7 Identity = 22/32 (68.75%), Postives = 26/32 (81.25%), Query Frame = 1 Query: 28 SPLSLKLWFVSVFLGVLGMPIGAALKMIPVGS 123 +PL+L W VS+ LG LGMP+ AALKMIPVGS Sbjct: 988 TPLNLGQWLVSIILGFLGMPVAAALKMIPVGS 1019 The following BLAST results are available for this feature:
BLAST of GR912908 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 2
BLAST of GR912908 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide) Total hits: 2
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >GR912908 ID=GR912908; Name=GR912908; organism=Cicer arietinum; type=EST; length=295bpback to top |