HO066706
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of HO066706 vs. SwissProt
Match: 4CL1_SOYBN (4-coumarate--CoA ligase 1 (Fragment) OS=Glycine max PE=2 SV=1) HSP 1 Score: 58.5362 bits (140), Expect = 1.198e-8 Identity = 28/33 (84.85%), Postives = 29/33 (87.88%), Query Frame = -2 Query: 117 QFVSKQVVFYKRXNRVFFXDAIXXSPSGKILRK 215 QF+SKQVVFYKR NRVFF DAI SPSGKILRK Sbjct: 249 QFISKQVVFYKRINRVFFIDAIPKSPSGKILRK 281
BLAST of HO066706 vs. SwissProt
Match: 4CL_VANPL (4-coumarate--CoA ligase OS=Vanilla planifolia GN=4CL PE=3 SV=1) HSP 1 Score: 55.4546 bits (132), Expect = 1.014e-7 Identity = 25/33 (75.76%), Postives = 29/33 (87.88%), Query Frame = -2 Query: 117 QFVSKQVVFYKRXNRVFFXDAIXXSPSGKILRK 215 QF+SKQV+FYKR NRVFF +AI +PSGKILRK Sbjct: 507 QFISKQVIFYKRINRVFFVEAIPKAPSGKILRK 539
BLAST of HO066706 vs. SwissProt
Match: 4CL2_PETCR (4-coumarate--CoA ligase 1 OS=Petroselinum crispum GN=4CL2 PE=2 SV=1) HSP 1 Score: 55.4546 bits (132), Expect = 1.014e-7 Identity = 28/33 (84.85%), Postives = 28/33 (84.85%), Query Frame = -2 Query: 117 QFVSKQVVFYKRXNRVFFXDAIXXSPSGKILRK 215 QFVSKQVVFYKR RVFF DAI SPSGKILRK Sbjct: 499 QFVSKQVVFYKRIFRVFFVDAIPKSPSGKILRK 531
BLAST of HO066706 vs. SwissProt
Match: 4CL2_ARATH (4-coumarate--CoA ligase 2 OS=Arabidopsis thaliana GN=4CL2 PE=1 SV=2) HSP 1 Score: 55.4546 bits (132), Expect = 1.014e-7 Identity = 26/33 (78.79%), Postives = 29/33 (87.88%), Query Frame = -2 Query: 117 QFVSKQVVFYKRXNRVFFXDAIXXSPSGKILRK 215 QFVSKQVVFYKR N+VFF D+I +PSGKILRK Sbjct: 512 QFVSKQVVFYKRINKVFFTDSIPKAPSGKILRK 544
BLAST of HO066706 vs. SwissProt
Match: 4CL1_PETCR (4-coumarate--CoA ligase 1 OS=Petroselinum crispum GN=4CL1 PE=2 SV=1) HSP 1 Score: 55.4546 bits (132), Expect = 1.014e-7 Identity = 28/33 (84.85%), Postives = 28/33 (84.85%), Query Frame = -2 Query: 117 QFVSKQVVFYKRXNRVFFXDAIXXSPSGKILRK 215 QFVSKQVVFYKR RVFF DAI SPSGKILRK Sbjct: 499 QFVSKQVVFYKRIFRVFFVDAIPKSPSGKILRK 531
BLAST of HO066706 vs. SwissProt
Match: 4CL2_TOBAC (4-coumarate--CoA ligase 2 OS=Nicotiana tabacum GN=4CL2 PE=2 SV=1) HSP 1 Score: 53.9138 bits (128), Expect = 1.782e-7 Identity = 25/32 (78.12%), Postives = 27/32 (84.38%), Query Frame = -2 Query: 117 FVSKQVVFYKRXNRVFFXDAIXXSPSGKILRK 212 F+SKQV+FYKR RVFF DAI SPSGKILRK Sbjct: 499 FISKQVIFYKRIKRVFFVDAIPKSPSGKILRK 530 HSP 2 Score: 20.4014 bits (41), Expect = 1.782e-7 Identity = 8/9 (88.89%), Postives = 9/9 (100.00%), Query Frame = -1 Query: 79 AKLAAGVPN 105 AKLAAG+PN Sbjct: 534 AKLAAGLPN 542
BLAST of HO066706 vs. SwissProt
Match: 4CL4_ORYSJ (Probable 4-coumarate--CoA ligase 4 OS=Oryza sativa subsp. japonica GN=4CL4 PE=2 SV=1) HSP 1 Score: 54.299 bits (129), Expect = 2.259e-7 Identity = 25/33 (75.76%), Postives = 29/33 (87.88%), Query Frame = -2 Query: 117 QFVSKQVVFYKRXNRVFFXDAIXXSPSGKILRK 215 QFV+K+VVFYKR N+VFF D+I SPSGKILRK Sbjct: 507 QFVAKEVVFYKRLNKVFFADSIPKSPSGKILRK 539
BLAST of HO066706 vs. SwissProt
Match: 4CL1_ARATH (4-coumarate--CoA ligase 1 OS=Arabidopsis thaliana GN=4CL1 PE=1 SV=1) HSP 1 Score: 53.9138 bits (128), Expect = 2.951e-7 Identity = 25/33 (75.76%), Postives = 29/33 (87.88%), Query Frame = -2 Query: 117 QFVSKQVVFYKRXNRVFFXDAIXXSPSGKILRK 215 QFVSKQVVFYKR N+VFF ++I +PSGKILRK Sbjct: 519 QFVSKQVVFYKRINKVFFTESIPKAPSGKILRK 551
BLAST of HO066706 vs. TrEMBL
Match: D2K6F7_9FABA (4-coumarate:CoA ligase OS=Galega orientalis GN=4CL PE=2 SV=1) HSP 1 Score: 58.5362 bits (140), Expect = 7.612e-8 Identity = 28/33 (84.85%), Postives = 29/33 (87.88%), Query Frame = -2 Query: 117 QFVSKQVVFYKRXNRVFFXDAIXXSPSGKILRK 215 QF+SKQVVFYKR NRVFF DAI SPSGKILRK Sbjct: 506 QFISKQVVFYKRINRVFFIDAIPKSPSGKILRK 538 HSP 2 Score: 21.557 bits (44), Expect = 7.612e-8 Identity = 9/9 (100.00%), Postives = 9/9 (100.00%), Query Frame = -1 Query: 79 AKLAAGVPN 105 AKLAAGVPN Sbjct: 542 AKLAAGVPN 550
BLAST of HO066706 vs. TrEMBL
Match: B8XCX9_9LAMI (4-coumarate coenzyme A ligase OS=Paulownia fortunei GN=4CL PE=2 SV=1) HSP 1 Score: 58.5362 bits (140), Expect = 1.660e-7 Identity = 28/33 (84.85%), Postives = 29/33 (87.88%), Query Frame = -2 Query: 117 QFVSKQVVFYKRXNRVFFXDAIXXSPSGKILRK 215 QF+SKQVVFYKR NRVFF DAI SPSGKILRK Sbjct: 499 QFISKQVVFYKRINRVFFIDAIPKSPSGKILRK 531 HSP 2 Score: 20.4014 bits (41), Expect = 1.660e-7 Identity = 8/9 (88.89%), Postives = 9/9 (100.00%), Query Frame = -1 Query: 79 AKLAAGVPN 105 A+LAAGVPN Sbjct: 535 ARLAAGVPN 543
BLAST of HO066706 vs. TrEMBL
Match: Q8S5C1_SOYBN (4-coumarate:CoA ligase isoenzyme 2 OS=Glycine max PE=2 SV=1) HSP 1 Score: 58.5362 bits (140), Expect = 2.512e-7 Identity = 28/33 (84.85%), Postives = 29/33 (87.88%), Query Frame = -2 Query: 117 QFVSKQVVFYKRXNRVFFXDAIXXSPSGKILRK 215 QF+SKQVVFYKR NRVFF DAI SPSGKILRK Sbjct: 503 QFISKQVVFYKRINRVFFIDAIPKSPSGKILRK 535
BLAST of HO066706 vs. TrEMBL
Match: Q8W558_9FABA (4-coumarate:CoA ligase OS=Amorpha fruticosa GN=4CL PE=2 SV=1) HSP 1 Score: 56.6102 bits (135), Expect = 2.791e-7 Identity = 27/33 (81.82%), Postives = 29/33 (87.88%), Query Frame = -2 Query: 117 QFVSKQVVFYKRXNRVFFXDAIXXSPSGKILRK 215 QF+SKQVVFYKR +RVFF DAI SPSGKILRK Sbjct: 496 QFISKQVVFYKRISRVFFIDAIPKSPSGKILRK 528 HSP 2 Score: 21.557 bits (44), Expect = 2.791e-7 Identity = 9/9 (100.00%), Postives = 9/9 (100.00%), Query Frame = -1 Query: 79 AKLAAGVPN 105 AKLAAGVPN Sbjct: 532 AKLAAGVPN 540
BLAST of HO066706 vs. TrEMBL
Match: Q67G17_SALMI (4-coumarate:coenzyme A ligase 2 OS=Salvia miltiorrhiza PE=2 SV=1) HSP 1 Score: 58.151 bits (139), Expect = 3.280e-7 Identity = 27/33 (81.82%), Postives = 29/33 (87.88%), Query Frame = -2 Query: 117 QFVSKQVVFYKRXNRVFFXDAIXXSPSGKILRK 215 QF+SKQV+FYKR NRVFF DAI SPSGKILRK Sbjct: 498 QFISKQVIFYKRINRVFFIDAIPKSPSGKILRK 530
BLAST of HO066706 vs. TrEMBL
Match: Q0GZS1_9BORA (4-coumarate:CoA ligase OS=Arnebia euchroma PE=2 SV=2) HSP 1 Score: 57.3806 bits (137), Expect = 5.596e-7 Identity = 27/33 (81.82%), Postives = 29/33 (87.88%), Query Frame = -2 Query: 117 QFVSKQVVFYKRXNRVFFXDAIXXSPSGKILRK 215 QFVSKQV+FYKR NRVFF D+I SPSGKILRK Sbjct: 501 QFVSKQVIFYKRINRVFFVDSIPKSPSGKILRK 533
BLAST of HO066706 vs. TrEMBL
Match: D5LLN7_SORAU (p-coumarate:CoA ligase 1 OS=Sorbus aucuparia PE=2 SV=1) HSP 1 Score: 56.9954 bits (136), Expect = 7.308e-7 Identity = 27/33 (81.82%), Postives = 29/33 (87.88%), Query Frame = -2 Query: 117 QFVSKQVVFYKRXNRVFFXDAIXXSPSGKILRK 215 QF+SKQVVFYKR NRVFF +AI SPSGKILRK Sbjct: 503 QFISKQVVFYKRINRVFFIEAIPKSPSGKILRK 535
BLAST of HO066706 vs. TrEMBL
Match: C0KKW5_HUMLU (4-coumarate:CoA ligase OS=Humulus lupulus PE=2 SV=1) HSP 1 Score: 56.9954 bits (136), Expect = 7.308e-7 Identity = 27/33 (81.82%), Postives = 29/33 (87.88%), Query Frame = -2 Query: 117 QFVSKQVVFYKRXNRVFFXDAIXXSPSGKILRK 215 QF+SKQVVFYKR NRVFF +AI SPSGKILRK Sbjct: 505 QFISKQVVFYKRINRVFFIEAIPKSPSGKILRK 537
BLAST of HO066706 vs. TrEMBL
Match: B3FES3_9ROSA (4-coumarate coenzyme A ligase (Fragment) OS=Eriobotrya japonica PE=2 SV=1) HSP 1 Score: 56.9954 bits (136), Expect = 7.308e-7 Identity = 27/33 (81.82%), Postives = 29/33 (87.88%), Query Frame = -2 Query: 117 QFVSKQVVFYKRXNRVFFXDAIXXSPSGKILRK 215 QF+SKQVVFYKR NRVFF +AI SPSGKILRK Sbjct: 302 QFISKQVVFYKRINRVFFIEAIPKSPSGKILRK 334
BLAST of HO066706 vs. TrEMBL
Match: Q2YHM7_PLAMJ (4-coumaryl-CoA ligase (Fragment) OS=Plantago major GN=4CL2 PE=2 SV=1) HSP 1 Score: 56.6102 bits (135), Expect = 9.545e-7 Identity = 26/33 (78.79%), Postives = 29/33 (87.88%), Query Frame = -2 Query: 117 QFVSKQVVFYKRXNRVFFXDAIXXSPSGKILRK 215 +F+SKQV+FYKR NRVFF DAI SPSGKILRK Sbjct: 79 KFISKQVIFYKRINRVFFIDAIPKSPSGKILRK 111
BLAST of HO066706 vs. TAIR peptide
Match: AT3G21240.1 (| Symbols: 4CL2, AT4CL2 | 4-coumarate:CoA ligase 2 | chr3:7454497-7457314 REVERSE LENGTH=556) HSP 1 Score: 55.4546 bits (132), Expect = 8.167e-9 Identity = 26/33 (78.79%), Postives = 29/33 (87.88%), Query Frame = -2 Query: 117 QFVSKQVVFYKRXNRVFFXDAIXXSPSGKILRK 215 QFVSKQVVFYKR N+VFF D+I +PSGKILRK Sbjct: 512 QFVSKQVVFYKRINKVFFTDSIPKAPSGKILRK 544
BLAST of HO066706 vs. TAIR peptide
Match: AT1G51680.1 (| Symbols: 4CL1, 4CL.1, AT4CL1 | 4-coumarate:CoA ligase 1 | chr1:19159007-19161464 REVERSE LENGTH=561) HSP 1 Score: 53.9138 bits (128), Expect = 2.376e-8 Identity = 25/33 (75.76%), Postives = 29/33 (87.88%), Query Frame = -2 Query: 117 QFVSKQVVFYKRXNRVFFXDAIXXSPSGKILRK 215 QFVSKQVVFYKR N+VFF ++I +PSGKILRK Sbjct: 519 QFVSKQVVFYKRINKVFFTESIPKAPSGKILRK 551
BLAST of HO066706 vs. TAIR peptide
Match: AT1G65060.1 (| Symbols: 4CL3 | 4-coumarate:CoA ligase 3 | chr1:24167385-24171457 REVERSE LENGTH=561) HSP 1 Score: 48.521 bits (114), Expect = 9.984e-7 Identity = 23/36 (63.89%), Postives = 29/36 (80.56%), Query Frame = -2 Query: 108 QFVSKQVVFYKRXNRVFFXDAIXXSPSGKILRKGPK 215 ++V+KQVVFYKR ++VFF +I SPSGKILRK K Sbjct: 522 EYVAKQVVFYKRLHKVFFVASIPKSPSGKILRKDLK 557 The following BLAST results are available for this feature:
BLAST of HO066706 vs. SwissProt
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Swissprot) Total hits: 8
BLAST of HO066706 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 10
BLAST of HO066706 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide) Total hits: 3
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >HO066706 ID=HO066706; Name=HO066706; organism=Cicer arietinum; type=EST; length=216bpback to top |