FE670351
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of FE670351 vs. TrEMBL
Match: B9GYC8_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_817169 PE=4 SV=1) HSP 1 Score: 60.077 bits (144), Expect = 8.643e-8 Identity = 27/37 (72.97%), Postives = 33/37 (89.19%), Query Frame = 3 Query: 135 VQYGIIGVGMMGREHLINV*HRRSEAVAVVAMADPHL 245 V+YGI+GVGMMGREHLIN+ H RS+ V VVA+ADPH+ Sbjct: 11 VKYGIVGVGMMGREHLINLYHLRSQNVGVVAIADPHV 47
BLAST of FE670351 vs. TrEMBL
Match: Q66GR2_ARATH (At4g17370 OS=Arabidopsis thaliana GN=At4g17370 PE=2 SV=1) HSP 1 Score: 56.9954 bits (136), Expect = 7.317e-7 Identity = 23/37 (62.16%), Postives = 31/37 (83.78%), Query Frame = 3 Query: 132 VVQYGIIGVGMMGREHLINV*HRRSEAVAVVAMADPH 242 + +YGI+G+GMMGREHLIN+ H R + +AVV +ADPH Sbjct: 9 ITKYGIVGIGMMGREHLINLHHLRDQGLAVVCIADPH 45
BLAST of FE670351 vs. TrEMBL
Match: O23580_ARATH (Inositol 2-dehydrogenase like protein OS=Arabidopsis thaliana GN=dl4720w PE=2 SV=1) HSP 1 Score: 56.9954 bits (136), Expect = 7.317e-7 Identity = 23/37 (62.16%), Postives = 31/37 (83.78%), Query Frame = 3 Query: 132 VVQYGIIGVGMMGREHLINV*HRRSEAVAVVAMADPH 242 + +YGI+G+GMMGREHLIN+ H R + +AVV +ADPH Sbjct: 9 ITKYGIVGIGMMGREHLINLHHLRDQGLAVVCIADPH 45
BLAST of FE670351 vs. TrEMBL
Match: B9SXD9_RICCO (Oxidoreductase, putative OS=Ricinus communis GN=RCOM_1388970 PE=4 SV=1) HSP 1 Score: 56.9954 bits (136), Expect = 7.317e-7 Identity = 26/37 (70.27%), Postives = 31/37 (83.78%), Query Frame = 3 Query: 135 VQYGIIGVGMMGREHLINV*HRRSEAVAVVAMADPHL 245 V+YGIIG GMMGREHLIN+ H R + VAVV +ADPH+ Sbjct: 5 VKYGIIGTGMMGREHLINLHHLRHQNVAVVCIADPHV 41
BLAST of FE670351 vs. TAIR peptide
Match: AT4G17370.1 (| Symbols: | Oxidoreductase family protein | chr4:9706188-9708142 FORWARD LENGTH=368) HSP 1 Score: 56.9954 bits (136), Expect = 2.836e-9 Identity = 23/37 (62.16%), Postives = 31/37 (83.78%), Query Frame = 3 Query: 132 VVQYGIIGVGMMGREHLINV*HRRSEAVAVVAMADPH 242 + +YGI+G+GMMGREHLIN+ H R + +AVV +ADPH Sbjct: 9 ITKYGIVGIGMMGREHLINLHHLRDQGLAVVCIADPH 45 The following BLAST results are available for this feature:
BLAST of FE670351 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 4
BLAST of FE670351 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide) Total hits: 1
InterPro
Analysis Name: InterProScan analysis for Cicer arietinum unigene v1
Date Performed: 2010-12-29
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >FE670351 ID=FE670351; Name=FE670351; organism=Cicer arietinum; type=EST; length=245bpback to top |