HO062563
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of HO062563 vs. TrEMBL
Match: B9SJ14_RICCO (Nucleic acid binding protein, putative OS=Ricinus communis GN=RCOM_0597580 PE=4 SV=1) HSP 1 Score: 60.8474 bits (146), Expect = 1.172e-7 Identity = 30/56 (53.57%), Postives = 37/56 (66.07%), Query Frame = -3 Query: 7 RNCYPRVRGGVELLSFLGFELKEENGETWALMEAPREEEKINFIKKAIVLLEPQLV 174 R V G VELL F+GFEL+EE GE WA ME P +EE++ I K I LLEP+ + Sbjct: 216 REAVSEVAGAVELLEFIGFELREEVGEMWAFMEVP-DEERVRLINKVIRLLEPRKI 270
BLAST of HO062563 vs. TAIR peptide
Match: AT2G01650.1 (| Symbols: PUX2 | plant UBX domain-containing protein 2 | chr2:284851-286394 REVERSE LENGTH=458) HSP 1 Score: 53.9138 bits (128), Expect = 9.696e-8 Identity = 27/46 (58.70%), Postives = 32/46 (69.57%), Query Frame = -3 Query: 19 VRGGVELLSFLGFELKEENGETWALMEAPREEEKINFIKKAIVLLE 156 V GGVELL +GFELKEEN E WA+M+ P EE+ I I K + LE Sbjct: 219 VAGGVELLELVGFELKEENDEIWAVMDVPSEEQSI-LINKVVGYLE 263 The following BLAST results are available for this feature:
BLAST of HO062563 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 1
BLAST of HO062563 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide) Total hits: 1
InterPro
Analysis Name: InterProScan analysis for Cicer arietinum unigene v1
Date Performed: 2010-12-29
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >HO062563 ID=HO062563; Name=HO062563; organism=Cicer arietinum; type=EST; length=695bpback to top |