HO066888
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of HO066888 vs. TrEMBL
Match: B7FKR1_MEDTR (Putative uncharacterized protein OS=Medicago truncatula PE=2 SV=1) HSP 1 Score: 68.9366 bits (167), Expect = 1.839e-10 Identity = 30/34 (88.24%), Postives = 32/34 (94.12%), Query Frame = 3 Query: 3 YDSAAFKMRGQKAILNFPLEAGVCHPKPNCCGKK 104 YDSAAF+MRGQKAILNFPLEAGVC PKPN CG+K Sbjct: 151 YDSAAFRMRGQKAILNFPLEAGVCDPKPNSCGRK 184
BLAST of HO066888 vs. TrEMBL
Match: B7FI36_MEDTR (Putative uncharacterized protein OS=Medicago truncatula PE=2 SV=1) HSP 1 Score: 68.9366 bits (167), Expect = 1.839e-10 Identity = 30/34 (88.24%), Postives = 32/34 (94.12%), Query Frame = 3 Query: 3 YDSAAFKMRGQKAILNFPLEAGVCHPKPNCCGKK 104 YDSAAF+MRGQKAILNFPLEAGVC PKPN CG+K Sbjct: 151 YDSAAFRMRGQKAILNFPLEAGVCDPKPNSCGRK 184
BLAST of HO066888 vs. TrEMBL
Match: C6SWD9_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1) HSP 1 Score: 63.1586 bits (152), Expect = 1.009e-8 Identity = 28/34 (82.35%), Postives = 30/34 (88.24%), Query Frame = 3 Query: 3 YDSAAFKMRGQKAILNFPLEAGVCHPKPNCCGKK 104 YD AAFKMRGQKAILNFPLEAG+ PKPN CG+K Sbjct: 154 YDCAAFKMRGQKAILNFPLEAGLSDPKPNSCGRK 187
BLAST of HO066888 vs. TrEMBL
Match: C6SY34_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1) HSP 1 Score: 57.7658 bits (138), Expect = 4.240e-7 Identity = 24/34 (70.59%), Postives = 29/34 (85.29%), Query Frame = 3 Query: 3 YDSAAFKMRGQKAILNFPLEAGVCHPKPNCCGKK 104 YD AAF+MRG KA+LNFPLEAG+ HP+PN G+K Sbjct: 149 YDCAAFRMRGHKAVLNFPLEAGMSHPEPNSSGRK 182
BLAST of HO066888 vs. TrEMBL
Match: C6SVY7_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1) HSP 1 Score: 57.7658 bits (138), Expect = 4.240e-7 Identity = 24/34 (70.59%), Postives = 29/34 (85.29%), Query Frame = 3 Query: 3 YDSAAFKMRGQKAILNFPLEAGVCHPKPNCCGKK 104 YD AAF+MRG KA+LNFPLEAG+ HP+PN G+K Sbjct: 151 YDCAAFRMRGHKAVLNFPLEAGMSHPEPNSSGRK 184
BLAST of HO066888 vs. TrEMBL
Match: C6T1Y0_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1) HSP 1 Score: 57.3806 bits (137), Expect = 5.538e-7 Identity = 28/35 (80.00%), Postives = 29/35 (82.86%), Query Frame = 3 Query: 3 YDSAAFKMRGQKAILNFPLEAGVCHPKP-NCCGKK 104 YD AAFKMRGQKAILNFPLEAG PKP N CG+K Sbjct: 172 YDCAAFKMRGQKAILNFPLEAGESDPKPNNSCGRK 206 The following BLAST results are available for this feature:
BLAST of HO066888 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 6
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >HO066888 ID=HO066888; Name=HO066888; organism=Cicer arietinum; type=EST; length=192bpback to top |