DY475179
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of DY475179 vs. SwissProt
Match: GDL61_ARATH (GDSL esterase/lipase At4g01130 OS=Arabidopsis thaliana GN=At4g01130 PE=2 SV=1) HSP 1 Score: 60.077 bits (144), Expect = 4.099e-9 Identity = 29/56 (51.79%), Postives = 40/56 (71.43%), Query Frame = 2 Query: 89 MSSNTFNXKLXFIFMLVLPCLXG-LSQGECDFKAIFNFGDSNSDTGGFYAAFPAES 253 M+S+ + + +L++ L G +CDF+AIFNFGDSNSDTGGF+AAFPA+S Sbjct: 1 MASDINRRRSFSLLVLIIVMLYGHKGDSKCDFEAIFNFGDSNSDTGGFWAAFPAQS 56
BLAST of DY475179 vs. TrEMBL
Match: C6T9G1_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1) HSP 1 Score: 74.7146 bits (182), Expect = 3.354e-12 Identity = 39/55 (70.91%), Postives = 42/55 (76.36%), Query Frame = 2 Query: 89 MSSNTFNXKLXFIFMLVLPCLXGLSQGECDFKAIFNFGDSNSDTGGFYAAFPAES 253 MSS F L IF LVL CL G S +CDFKAIFNFGDSNSDTGGF+AAFPA+S Sbjct: 1 MSSKPFTNFLV-IFTLVLLCLVGSSHTKCDFKAIFNFGDSNSDTGGFWAAFPAQS 54
BLAST of DY475179 vs. TrEMBL
Match: A9P0U3_PICSI (Putative uncharacterized protein OS=Picea sitchensis PE=2 SV=1) HSP 1 Score: 64.3142 bits (155), Expect = 4.532e-9 Identity = 30/40 (75.00%), Postives = 33/40 (82.50%), Query Frame = 2 Query: 134 LVLPCLXGLSQGECDFKAIFNFGDSNSDTGGFYAAFPAES 253 L++ C SQG+C F AIFNFGDSNSDTGGFYAAFPAES Sbjct: 29 LMIFCQVESSQGKCAFPAIFNFGDSNSDTGGFYAAFPAES 68
BLAST of DY475179 vs. TrEMBL
Match: Q4U4K2_DIGGR (Lanatoside 15-O-acetylesterase OS=Digitalis grandiflora PE=2 SV=1) HSP 1 Score: 63.1586 bits (152), Expect = 1.010e-8 Identity = 30/46 (65.22%), Postives = 37/46 (80.43%), Query Frame = 2 Query: 128 FMLVLPCLXG----LSQGECDFKAIFNFGDSNSDTGGFYAAFPAES 253 FM+ + L G +S+ +CDFKAIFNFGDSNSDTGGF+AAFPAE+ Sbjct: 12 FMVYVVVLMGVSVRMSEAKCDFKAIFNFGDSNSDTGGFWAAFPAEN 57
BLAST of DY475179 vs. TrEMBL
Match: B9RE15_RICCO (Esterase, putative OS=Ricinus communis GN=RCOM_1617320 PE=4 SV=1) HSP 1 Score: 62.7734 bits (151), Expect = 1.319e-8 Identity = 31/59 (52.54%), Postives = 40/59 (67.80%), Query Frame = 2 Query: 77 KLPKMSSNTFNXKLXFIFMLVLPCLXGLSQGECDFKAIFNFGDSNSDTGGFYAAFPAES 253 +LP + F F M+ + L LS +C+F+AIFNFGDSNSDTGGF+AAFPA+S Sbjct: 5 RLPSKPAVLFRQLPVFCIMM-MAMLNSLSHSKCEFEAIFNFGDSNSDTGGFWAAFPAQS 62
BLAST of DY475179 vs. TrEMBL
Match: Q4U4K1_9LAMI (Lanatoside 15-O-acetylesterase OS=Digitalis subalpina PE=2 SV=1) HSP 1 Score: 61.2326 bits (147), Expect = 3.837e-8 Identity = 26/31 (83.87%), Postives = 30/31 (96.77%), Query Frame = 2 Query: 161 SQGECDFKAIFNFGDSNSDTGGFYAAFPAES 253 S+ +CDFKAIFNFGDSNSDTGGF+AAFPAE+ Sbjct: 27 SEAKCDFKAIFNFGDSNSDTGGFWAAFPAEN 57
BLAST of DY475179 vs. TrEMBL
Match: O82681_DIGLA (Lanatoside 15'-O-acetylesterase OS=Digitalis lanata PE=2 SV=1) HSP 1 Score: 61.2326 bits (147), Expect = 3.837e-8 Identity = 26/31 (83.87%), Postives = 30/31 (96.77%), Query Frame = 2 Query: 161 SQGECDFKAIFNFGDSNSDTGGFYAAFPAES 253 S+ +CDFKAIFNFGDSNSDTGGF+AAFPAE+ Sbjct: 27 SESKCDFKAIFNFGDSNSDTGGFWAAFPAEN 57
BLAST of DY475179 vs. TrEMBL
Match: D7M4Y6_ARALY (Predicted protein OS=Arabidopsis lyrata subsp. lyrata GN=ARALYDRAFT_663833 PE=4 SV=1) HSP 1 Score: 60.4622 bits (145), Expect = 6.545e-8 Identity = 29/56 (51.79%), Postives = 41/56 (73.21%), Query Frame = 2 Query: 89 MSSNTFNXKLXFIFMLVLPCLXG-LSQGECDFKAIFNFGDSNSDTGGFYAAFPAES 253 M+S+ + + +L++ L G + +CDF+AIFNFGDSNSDTGGF+AAFPA+S Sbjct: 1 MASDLNRRRSFSLLVLIIVMLYGHKADSKCDFEAIFNFGDSNSDTGGFWAAFPAQS 56
BLAST of DY475179 vs. TrEMBL
Match: Q4U4K3_DIGLA (Lanatoside 15-O-acetylesterase OS=Digitalis lanata PE=2 SV=1) HSP 1 Score: 60.077 bits (144), Expect = 8.548e-8 Identity = 28/44 (63.64%), Postives = 37/44 (84.09%), Query Frame = 2 Query: 125 IFMLVLPCLXGLS-QGECDFKAIFNFGDSNSDTGGFYAAFPAES 253 ++++VL + G S + +CDF AIFNFGDSNSDTGGF+AAFPAE+ Sbjct: 14 VYVVVLMEVSGRSSEAKCDFNAIFNFGDSNSDTGGFWAAFPAEN 57
BLAST of DY475179 vs. TrEMBL
Match: B9I8T7_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_807357 PE=4 SV=1) HSP 1 Score: 59.3066 bits (142), Expect = 1.458e-7 Identity = 25/43 (58.14%), Postives = 35/43 (81.40%), Query Frame = 2 Query: 125 IFMLVLPCLXGLSQGECDFKAIFNFGDSNSDTGGFYAAFPAES 253 ++++++ S +CDF+AIFNFGDSNSDTGGF+AAFPA+S Sbjct: 8 VWVVMVAMWGSASYSKCDFEAIFNFGDSNSDTGGFWAAFPAQS 50
BLAST of DY475179 vs. TrEMBL
Match: Q4U0W1_DIGLA (Lanatoside 15'-O-acetylesterase OS=Digitalis lanata PE=4 SV=1) HSP 1 Score: 57.7658 bits (138), Expect = 4.242e-7 Identity = 25/31 (80.65%), Postives = 29/31 (93.55%), Query Frame = 2 Query: 161 SQGECDFKAIFNFGDSNSDTGGFYAAFPAES 253 S+ +C FKAIFNFGDSNSDTGGF+AAFPAE+ Sbjct: 27 SEAKCYFKAIFNFGDSNSDTGGFWAAFPAEN 57
BLAST of DY475179 vs. TAIR peptide
Match: AT4G01130.1 (| Symbols: | GDSL-like Lipase/Acylhydrolase superfamily protein | chr4:485868-488007 FORWARD LENGTH=382) HSP 1 Score: 60.077 bits (144), Expect = 3.322e-10 Identity = 29/56 (51.79%), Postives = 40/56 (71.43%), Query Frame = 2 Query: 89 MSSNTFNXKLXFIFMLVLPCLXG-LSQGECDFKAIFNFGDSNSDTGGFYAAFPAES 253 M+S+ + + +L++ L G +CDF+AIFNFGDSNSDTGGF+AAFPA+S Sbjct: 1 MASDINRRRSFSLLVLIIVMLYGHKGDSKCDFEAIFNFGDSNSDTGGFWAAFPAQS 56 The following BLAST results are available for this feature:
BLAST of DY475179 vs. SwissProt
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Swissprot) Total hits: 1
BLAST of DY475179 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 10
BLAST of DY475179 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide) Total hits: 1
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >DY475179 ID=DY475179; Name=DY475179; organism=Cicer arietinum; type=EST; length=255bpback to top |