GR393305
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of GR393305 vs. TrEMBL
Match: B9RJD3_RICCO (Transcription factor TGA7, putative OS=Ricinus communis GN=RCOM_1033270 PE=3 SV=1) HSP 1 Score: 61.6178 bits (148), Expect = 2.935e-8 Identity = 30/72 (41.67%), Postives = 48/72 (66.67%), Query Frame = 1 Query: 94 RLMDIYEPFQQVSMWGDSFKVEGGLNSIASPMLLVNTSMENKSEFIPHEPRDSSGADQETTNKDDSKALRRL 309 R M IYEPF Q+S WGD+F+ +G LN +S ++ V+T + +K+E++ + + S +DQE +N+ K RRL Sbjct: 12 RGMGIYEPFHQISSWGDTFRGDGSLNVGSSTIVPVDTGINDKTEYVSQDSMEHSRSDQE-SNRPTDKIQRRL 82
BLAST of GR393305 vs. TrEMBL
Match: A9PA07_POPTR (Putative uncharacterized protein OS=Populus trichocarpa PE=2 SV=1) HSP 1 Score: 58.151 bits (139), Expect = 3.245e-7 Identity = 29/72 (40.28%), Postives = 44/72 (61.11%), Query Frame = 1 Query: 94 RLMDIYEPFQQVSMWGDSFKVEGGLNSIASPMLLVNTSMENKSEFIPHEPRDSSGADQETTNKDDSKALRRL 309 R M YEPF Q+S WG +++ +G LN S ++ V+ ++NK+E + HE + S +DQE +K K RRL Sbjct: 12 RGMGFYEPFHQISSWGHAYRDDGSLNIGPSTIVQVDAGLDNKTEHVSHESMEPSRSDQE-AHKPADKIQRRL 82 The following BLAST results are available for this feature:
BLAST of GR393305 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 2
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >GR393305 ID=GR393305; Name=GR393305; organism=Cicer arietinum; type=EST; length=311bpback to top |