FE672540
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of FE672540 vs. TAIR peptide
Match: AT5G23720.3 (| Symbols: PHS1 | dual specificity protein phosphatase family protein | chr5:7998506-8002594 FORWARD LENGTH=920) HSP 1 Score: 49.6766 bits (117), Expect = 7.649e-7 Identity = 23/39 (58.97%), Postives = 29/39 (74.36%), Query Frame = 1 Query: 322 NNEYQGLSPLNVTSRVLYM*GDITARPAFMFTQWLQSVR 438 ++E++ PL VTSRVLYM GDI + PA+ FTQWL VR Sbjct: 17 HDEHESPLPLTVTSRVLYMLGDIASGPAYRFTQWLDLVR 55
BLAST of FE672540 vs. TAIR peptide
Match: AT5G23720.1 (| Symbols: PHS1 | dual specificity protein phosphatase family protein | chr5:7998309-8002594 FORWARD LENGTH=929) HSP 1 Score: 49.6766 bits (117), Expect = 7.649e-7 Identity = 23/39 (58.97%), Postives = 29/39 (74.36%), Query Frame = 1 Query: 322 NNEYQGLSPLNVTSRVLYM*GDITARPAFMFTQWLQSVR 438 ++E++ PL VTSRVLYM GDI + PA+ FTQWL VR Sbjct: 26 HDEHESPLPLTVTSRVLYMLGDIASGPAYRFTQWLDLVR 64 The following BLAST results are available for this feature:
BLAST of FE672540 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide) Total hits: 2
InterPro
Analysis Name: InterProScan analysis for Cicer arietinum unigene v1
Date Performed: 2010-12-29
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >FE672540 ID=FE672540; Name=FE672540; organism=Cicer arietinum; type=EST; length=439bpback to top |