ES560304
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of ES560304 vs. TrEMBL
Match: C6TC53_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1) HSP 1 Score: 112.849 bits (281), Expect = 1.093e-23 Identity = 52/56 (92.86%), Postives = 53/56 (94.64%), Query Frame = -3 Query: 3 PAELSLTAWICLMGIIEGSIASLIFERDMSVWVIGWDSRLLACVYSGVICSGMAYY 170 PAELSLTAWIC+MGIIEGSIAS IFERD SVW IGWDSRLLACVYSGVICSGMAYY Sbjct: 224 PAELSLTAWICVMGIIEGSIASFIFERDFSVWAIGWDSRLLACVYSGVICSGMAYY 279
BLAST of ES560304 vs. TrEMBL
Match: C6TJW0_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1) HSP 1 Score: 103.99 bits (258), Expect = 5.079e-21 Identity = 47/56 (83.93%), Postives = 52/56 (92.86%), Query Frame = -3 Query: 3 PAELSLTAWICLMGIIEGSIASLIFERDMSVWVIGWDSRLLACVYSGVICSGMAYY 170 PAELS+TAWIC +GI EG+IA+LIFERDMSVW IG DSRLLACVYSGV+CSGMAYY Sbjct: 221 PAELSVTAWICFLGIFEGAIATLIFERDMSVWSIGMDSRLLACVYSGVVCSGMAYY 276
BLAST of ES560304 vs. TrEMBL
Match: B7FJ06_MEDTR (Putative uncharacterized protein (Fragment) OS=Medicago truncatula PE=2 SV=1) HSP 1 Score: 103.219 bits (256), Expect = 8.663e-21 Identity = 45/56 (80.36%), Postives = 51/56 (91.07%), Query Frame = -3 Query: 3 PAELSLTAWICLMGIIEGSIASLIFERDMSVWVIGWDSRLLACVYSGVICSGMAYY 170 PAELS+TAWIC +GI EG IA+LIFERD SVW IG+DSRLLACVYSG++CSGMAYY Sbjct: 217 PAELSMTAWICFLGIFEGGIATLIFERDFSVWAIGFDSRLLACVYSGIVCSGMAYY 272
BLAST of ES560304 vs. TrEMBL
Match: B9RJ73_RICCO (Auxin-induced protein 5NG4, putative OS=Ricinus communis GN=RCOM_1031940 PE=4 SV=1) HSP 1 Score: 89.7373 bits (221), Expect = 9.912e-17 Identity = 42/56 (75.00%), Postives = 47/56 (83.93%), Query Frame = -3 Query: 3 PAELSLTAWICLMGIIEGSIASLIFERDMSVWVIGWDSRLLACVYSGVICSGMAYY 170 PAELSLTA ICLMG +EG+ SLI ERDMS W IG+DSRLLA VY+GV+CSG AYY Sbjct: 218 PAELSLTALICLMGTVEGAAVSLIMERDMSAWKIGFDSRLLAAVYTGVVCSGCAYY 273
BLAST of ES560304 vs. TrEMBL
Match: B9H7D2_POPTR (Predicted protein (Fragment) OS=Populus trichocarpa GN=POPTRDRAFT_209853 PE=4 SV=1) HSP 1 Score: 88.5817 bits (218), Expect = 2.208e-16 Identity = 39/56 (69.64%), Postives = 47/56 (83.93%), Query Frame = -3 Query: 3 PAELSLTAWICLMGIIEGSIASLIFERDMSVWVIGWDSRLLACVYSGVICSGMAYY 170 PAELSLTA IC+MG++EG+ SL+ ERDM W IG+DSRLLA YSGV+CSG+AYY Sbjct: 205 PAELSLTALICVMGVVEGAAVSLVMERDMGAWKIGFDSRLLAAAYSGVVCSGIAYY 260
BLAST of ES560304 vs. TrEMBL
Match: B9GU55_POPTR (Predicted protein (Fragment) OS=Populus trichocarpa GN=POPTRDRAFT_410051 PE=4 SV=1) HSP 1 Score: 87.4261 bits (215), Expect = 4.919e-16 Identity = 39/56 (69.64%), Postives = 47/56 (83.93%), Query Frame = -3 Query: 3 PAELSLTAWICLMGIIEGSIASLIFERDMSVWVIGWDSRLLACVYSGVICSGMAYY 170 PAELSLTA IC+ G++EG+ SL+ ERDMS W IG+DSRLLA YSGV+CSG+AYY Sbjct: 206 PAELSLTALICMTGMVEGAAVSLVMERDMSAWKIGFDSRLLAAAYSGVVCSGIAYY 261
BLAST of ES560304 vs. TrEMBL
Match: B2ZAQ4_9ROSI (Putative nodulin-like protein OS=Gossypioides kirkii PE=4 SV=1) HSP 1 Score: 87.4261 bits (215), Expect = 4.919e-16 Identity = 38/56 (67.86%), Postives = 45/56 (80.36%), Query Frame = -3 Query: 3 PAELSLTAWICLMGIIEGSIASLIFERDMSVWVIGWDSRLLACVYSGVICSGMAYY 170 PAELSLTAWIC MG++EG+ SLI RD+ W IGW+SRLLA YSGV+CSG+ YY Sbjct: 218 PAELSLTAWICFMGMLEGAGVSLIMVRDLRAWKIGWNSRLLAATYSGVVCSGITYY 273
BLAST of ES560304 vs. TrEMBL
Match: B9T7W2_RICCO (Putative uncharacterized protein OS=Ricinus communis GN=RCOM_0120130 PE=4 SV=1) HSP 1 Score: 86.2705 bits (212), Expect = 1.096e-15 Identity = 38/57 (66.67%), Postives = 48/57 (84.21%), Query Frame = -3 Query: 3 PAELSLTAWICLMGIIEGSIASLIFER-DMSVWVIGWDSRLLACVYSGVICSGMAYY 170 PAELSLTAWICL+G IEGSI +++ ER + SVW + WD++L+A VYSGV+CSG AYY Sbjct: 59 PAELSLTAWICLLGTIEGSIVAMVMERGNNSVWALHWDTKLIAAVYSGVVCSGFAYY 115
BLAST of ES560304 vs. TrEMBL
Match: B9HBJ2_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_866964 PE=4 SV=1) HSP 1 Score: 83.1889 bits (204), Expect = 9.277e-15 Identity = 37/57 (64.91%), Postives = 45/57 (78.95%), Query Frame = -3 Query: 3 PAELSLTAWICLMGIIEGSIASLIFERDM-SVWVIGWDSRLLACVYSGVICSGMAYY 170 PAELSLTAWICL+G IEG++ +L+ E SVW I WD +LLA VYSG+ CSG+AYY Sbjct: 209 PAELSLTAWICLLGTIEGAVVALVAENGKPSVWAINWDMKLLAAVYSGIFCSGLAYY 265
BLAST of ES560304 vs. TrEMBL
Match: Q9ZUS1_ARATH (Nodulin-like protein OS=Arabidopsis thaliana GN=At2g37460/F3G5.25 PE=2 SV=1) HSP 1 Score: 82.0333 bits (201), Expect = 2.067e-14 Identity = 35/57 (61.40%), Postives = 45/57 (78.95%), Query Frame = -3 Query: 3 PAELSLTAWICLMGIIEGSIASLIFER-DMSVWVIGWDSRLLACVYSGVICSGMAYY 170 PAELSLTAWICLMG IEG+ +L+ E+ + S W IGWD++LL YSG++CS +AYY Sbjct: 213 PAELSLTAWICLMGTIEGTAVALVMEKGNPSAWAIGWDTKLLTATYSGIVCSALAYY 269
BLAST of ES560304 vs. TAIR peptide
Match: AT2G37460.1 (| Symbols: | nodulin MtN21 /EamA-like transporter family protein | chr2:15726667-15729010 REVERSE LENGTH=380) HSP 1 Score: 82.0333 bits (201), Expect = 8.158e-17 Identity = 35/57 (61.40%), Postives = 45/57 (78.95%), Query Frame = -3 Query: 3 PAELSLTAWICLMGIIEGSIASLIFER-DMSVWVIGWDSRLLACVYSGVICSGMAYY 170 PAELSLTAWICLMG IEG+ +L+ E+ + S W IGWD++LL YSG++CS +AYY Sbjct: 213 PAELSLTAWICLMGTIEGTAVALVMEKGNPSAWAIGWDTKLLTATYSGIVCSALAYY 269
BLAST of ES560304 vs. TAIR peptide
Match: AT4G08300.1 (| Symbols: | nodulin MtN21 /EamA-like transporter family protein | chr4:5245024-5248153 FORWARD LENGTH=373) HSP 1 Score: 80.4925 bits (197), Expect = 2.373e-16 Identity = 37/56 (66.07%), Postives = 42/56 (75.00%), Query Frame = -3 Query: 3 PAELSLTAWICLMGIIEGSIASLIFERDMSVWVIGWDSRLLACVYSGVICSGMAYY 170 PAELSL WIC MG + +IASLI RD+S W +G DS LA VYSGV+CSGMAYY Sbjct: 214 PAELSLVMWICAMGTVLNTIASLIMVRDVSAWKVGMDSGTLAAVYSGVVCSGMAYY 269
BLAST of ES560304 vs. TAIR peptide
Match: AT1G21890.1 (| Symbols: | nodulin MtN21 /EamA-like transporter family protein | chr1:7682808-7685581 REVERSE LENGTH=389) HSP 1 Score: 80.1073 bits (196), Expect = 3.100e-16 Identity = 37/56 (66.07%), Postives = 43/56 (76.79%), Query Frame = -3 Query: 3 PAELSLTAWICLMGIIEGSIASLIFERDMSVWVIGWDSRLLACVYSGVICSGMAYY 170 PAELSLT ICLMG +EG+ SL+ RD+S W IG+DS L A YSGVICSG+AYY Sbjct: 220 PAELSLTTLICLMGTLEGTAVSLVTVRDLSAWKIGFDSNLFAAAYSGVICSGVAYY 275
BLAST of ES560304 vs. TAIR peptide
Match: AT2G37450.2 (| Symbols: | nodulin MtN21 /EamA-like transporter family protein | chr2:15722828-15724851 REVERSE LENGTH=336) HSP 1 Score: 77.0258 bits (188), Expect = 2.624e-15 Identity = 32/57 (56.14%), Postives = 43/57 (75.44%), Query Frame = -3 Query: 3 PAELSLTAWICLMGIIEGSIASLIFER-DMSVWVIGWDSRLLACVYSGVICSGMAYY 170 PAELSL WICL+G IEG + +L+ E+ + SVW IGWD++LL YSG++CS + YY Sbjct: 186 PAELSLATWICLIGTIEGVVVALVMEKGNPSVWAIGWDTKLLTITYSGIVCSALGYY 242
BLAST of ES560304 vs. TAIR peptide
Match: AT2G37450.1 (| Symbols: | nodulin MtN21 /EamA-like transporter family protein | chr2:15722828-15724851 REVERSE LENGTH=297) HSP 1 Score: 77.0258 bits (188), Expect = 2.624e-15 Identity = 32/57 (56.14%), Postives = 43/57 (75.44%), Query Frame = -3 Query: 3 PAELSLTAWICLMGIIEGSIASLIFER-DMSVWVIGWDSRLLACVYSGVICSGMAYY 170 PAELSL WICL+G IEG + +L+ E+ + SVW IGWD++LL YSG++CS + YY Sbjct: 147 PAELSLATWICLIGTIEGVVVALVMEKGNPSVWAIGWDTKLLTITYSGIVCSALGYY 203
BLAST of ES560304 vs. TAIR peptide
Match: AT1G44800.1 (| Symbols: | nodulin MtN21 /EamA-like transporter family protein | chr1:16914342-16916858 REVERSE LENGTH=370) HSP 1 Score: 71.2478 bits (173), Expect = 1.440e-13 Identity = 36/56 (64.29%), Postives = 40/56 (71.43%), Query Frame = -3 Query: 3 PAELSLTAWICLMGIIEGSIASLIFERDMSVWVIGWDSRLLACVYSGVICSGMAYY 170 PAELSL IC +G I +IASLI RD S W IG DS LA VYSGV+CSG+AYY Sbjct: 211 PAELSLVTLICGIGTILNAIASLIMVRDPSAWKIGMDSGTLAAVYSGVVCSGIAYY 266
BLAST of ES560304 vs. TAIR peptide
Match: AT2G39510.1 (| Symbols: | nodulin MtN21 /EamA-like transporter family protein | chr2:16491358-16493085 REVERSE LENGTH=374) HSP 1 Score: 69.3218 bits (168), Expect = 5.472e-13 Identity = 34/57 (59.65%), Postives = 41/57 (71.93%), Query Frame = -3 Query: 3 PAELSLTAWICLMGIIEGSIASLIFER-DMSVWVIGWDSRLLACVYSGVICSGMAYY 170 P ELSLTA+IC +G IE +I +L ER + S W I DS+LLA VY GVICSG+ YY Sbjct: 208 PVELSLTAYICFLGSIESTIVALFIERGNPSAWAIHLDSKLLAAVYGGVICSGIGYY 264
BLAST of ES560304 vs. TAIR peptide
Match: AT4G08290.1 (| Symbols: | nodulin MtN21 /EamA-like transporter family protein | chr4:5239088-5240861 FORWARD LENGTH=384) HSP 1 Score: 65.855 bits (159), Expect = 6.050e-12 Identity = 27/56 (48.21%), Postives = 40/56 (71.43%), Query Frame = -3 Query: 3 PAELSLTAWICLMGIIEGSIASLIFERDMSVWVIGWDSRLLACVYSGVICSGMAYY 170 PA+LSL+A ICL G ++ +L+ ER S W +GWD+RL A +Y+G++ SG+ YY Sbjct: 215 PADLSLSALICLAGAVQSFAVALVVERHPSGWAVGWDARLFAPLYTGIVSSGITYY 270
BLAST of ES560304 vs. TAIR peptide
Match: AT5G13670.1 (| Symbols: | nodulin MtN21 /EamA-like transporter family protein | chr5:4407205-4408955 REVERSE LENGTH=377) HSP 1 Score: 60.077 bits (144), Expect = 3.320e-10 Identity = 31/56 (55.36%), Postives = 43/56 (76.79%), Query Frame = -3 Query: 3 AELSLTAWICLMGIIEGSIASLIFER-DMSVWVIGWDSRLLACVYSGVICSGMAYY 167 AELSLTA +C+MG++E ++ LI+ER +MSVW I D LLA +Y G++ SG+AYY Sbjct: 212 AELSLTALMCIMGMLEATVMGLIWERKNMSVWKINPDVTLLASIYGGLV-SGLAYY 266
BLAST of ES560304 vs. TAIR peptide
Match: AT5G07050.1 (| Symbols: | nodulin MtN21 /EamA-like transporter family protein | chr5:2191533-2193416 REVERSE LENGTH=402) HSP 1 Score: 57.7658 bits (138), Expect = 1.648e-9 Identity = 23/54 (42.59%), Postives = 34/54 (62.96%), Query Frame = -3 Query: 3 ELSLTAWICLMGIIEGSIASLIFERDMSVWVIGWDSRLLACVYSGVICSGMAYY 164 +LSLT IC +G ++ + + E + S W IGWD LLA YSG++ S ++YY Sbjct: 228 QLSLTTLICFIGTLQAVAVTFVMEHNPSAWRIGWDMNLLAAAYSGIVASSISYY 281 The following BLAST results are available for this feature:
BLAST of ES560304 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 10
BLAST of ES560304 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide) Total hits: 10
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >ES560304 ID=ES560304; Name=ES560304; organism=Cicer arietinum; type=EST; length=172bpback to top |