GR913491
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of GR913491 vs. SwissProt
Match: 6DCS_SOYBN (NAD(P)H-dependent 6'-deoxychalcone synthase OS=Glycine max PE=1 SV=1) HSP 1 Score: 67.3958 bits (163), Expect = 2.583e-11 Identity = 28/54 (51.85%), Postives = 43/54 (79.63%), Query Frame = 1 Query: 13 SAPKVPEVVLSSSSGQRKMPVIGLGTAPEAIRKVTTKDAVLEAIKQGYRHFDAA 174 +A ++P +V +SS Q++MPV+G+G+AP+ K TK+A++EA+KQGYRHFD A Sbjct: 3 AAIEIPTIVFPNSSAQQRMPVVGMGSAPDFTCKKDTKEAIIEAVKQGYRHFDTA 56
BLAST of GR913491 vs. TrEMBL
Match: B7FI34_MEDTR (Putative uncharacterized protein OS=Medicago truncatula PE=2 SV=1) HSP 1 Score: 92.8189 bits (229), Expect = 1.163e-17 Identity = 46/54 (85.19%), Postives = 49/54 (90.74%), Query Frame = 1 Query: 13 SAPKVPEVVLSSSSGQRKMPVIGLGTAPEAIRKVTTKDAVLEAIKQGYRHFDAA 174 + P VPEVVL SS+GQRKMPV+GLGTAPEA KVTTKDAVLEAIKQGYRHFDAA Sbjct: 3 ATPTVPEVVLPSSTGQRKMPVMGLGTAPEATCKVTTKDAVLEAIKQGYRHFDAA 56
BLAST of GR913491 vs. TrEMBL
Match: C6TH10_SOYBN (Putative uncharacterized protein OS=Glycine max PE=4 SV=1) HSP 1 Score: 83.9593 bits (206), Expect = 5.402e-15 Identity = 42/50 (84.00%), Postives = 44/50 (88.00%), Query Frame = 1 Query: 25 VPEVVLSSSSGQRKMPVIGLGTAPEAIRKVTTKDAVLEAIKQGYRHFDAA 174 V EV L SSSGQRKMP++GLGTAPEA VTTKDAVLEAIKQGYRHFDAA Sbjct: 7 VSEVTLPSSSGQRKMPLMGLGTAPEATSAVTTKDAVLEAIKQGYRHFDAA 56
BLAST of GR913491 vs. TrEMBL
Match: A1IHM7_LOTJA (Polyketide reductase OS=Lotus japonicus GN=PKR1 PE=2 SV=1) HSP 1 Score: 68.9366 bits (167), Expect = 1.798e-10 Identity = 30/51 (58.82%), Postives = 43/51 (84.31%), Query Frame = 1 Query: 22 KVPEVVLSSSSGQRKMPVIGLGTAPEAIRKVTTKDAVLEAIKQGYRHFDAA 174 ++P VL++SSGQ+++PVIG+G+AP+ K T+DA++EAIKQGYRHFD A Sbjct: 6 EIPTKVLTNSSGQQRIPVIGMGSAPDFTCKKDTRDAIIEAIKQGYRHFDTA 56
BLAST of GR913491 vs. TrEMBL
Match: B5LY00_SOYBN (Chalcone reductase OS=Glycine max PE=2 SV=1) HSP 1 Score: 68.1662 bits (165), Expect = 3.067e-10 Identity = 30/53 (56.60%), Postives = 43/53 (81.13%), Query Frame = 1 Query: 16 APKVPEVVLSSSSGQRKMPVIGLGTAPEAIRKVTTKDAVLEAIKQGYRHFDAA 174 A ++P +VL +SS Q+++PV+G+G+AP+ K TKDA++EAIKQGYRHFD A Sbjct: 3 AIEIPTLVLPNSSSQQRVPVVGMGSAPDFTCKKDTKDAIIEAIKQGYRHFDTA 55
BLAST of GR913491 vs. TrEMBL
Match: Q43556_MEDSA (Chalcone reductase OS=Medicago sativa GN=CHR PE=2 SV=1) HSP 1 Score: 67.781 bits (164), Expect = 4.006e-10 Identity = 30/51 (58.82%), Postives = 41/51 (80.39%), Query Frame = 1 Query: 22 KVPEVVLSSSSGQRKMPVIGLGTAPEAIRKVTTKDAVLEAIKQGYRHFDAA 174 ++P VL+++S Q KMPV+G+G+AP+ K TKDA++EAIKQGYRHFD A Sbjct: 5 EIPTKVLTNTSSQLKMPVVGMGSAPDFTCKKDTKDAIIEAIKQGYRHFDTA 55
BLAST of GR913491 vs. TrEMBL
Match: Q43555_MEDSA (Chalcone reductase OS=Medicago sativa GN=CHR PE=2 SV=1) HSP 1 Score: 67.781 bits (164), Expect = 4.006e-10 Identity = 30/51 (58.82%), Postives = 41/51 (80.39%), Query Frame = 1 Query: 22 KVPEVVLSSSSGQRKMPVIGLGTAPEAIRKVTTKDAVLEAIKQGYRHFDAA 174 ++P VL+++S Q KMPV+G+G+AP+ K TKDA++EAIKQGYRHFD A Sbjct: 5 EIPTKVLTNTSSQLKMPVVGMGSAPDFTCKKDTKDAIIEAIKQGYRHFDTA 55
BLAST of GR913491 vs. TrEMBL
Match: Q40333_MEDSA (Chalcone reductase OS=Medicago sativa GN=CHR PE=2 SV=1) HSP 1 Score: 67.781 bits (164), Expect = 4.006e-10 Identity = 30/51 (58.82%), Postives = 41/51 (80.39%), Query Frame = 1 Query: 22 KVPEVVLSSSSGQRKMPVIGLGTAPEAIRKVTTKDAVLEAIKQGYRHFDAA 174 ++P VL+++S Q KMPV+G+G+AP+ K TKDA++EAIKQGYRHFD A Sbjct: 5 EIPTKVLTNTSSQLKMPVVGMGSAPDFTCKKDTKDAIIEAIKQGYRHFDTA 55
BLAST of GR913491 vs. TrEMBL
Match: Q40310_MEDSA (Chalcone reductase OS=Medicago sativa GN=CHR PE=2 SV=1) HSP 1 Score: 67.781 bits (164), Expect = 4.006e-10 Identity = 30/51 (58.82%), Postives = 41/51 (80.39%), Query Frame = 1 Query: 22 KVPEVVLSSSSGQRKMPVIGLGTAPEAIRKVTTKDAVLEAIKQGYRHFDAA 174 ++P VL+++S Q KMPV+G+G+AP+ K TKDA++EAIKQGYRHFD A Sbjct: 5 EIPTKVLTNTSSQLKMPVVGMGSAPDFTCKKDTKDAIIEAIKQGYRHFDTA 55
BLAST of GR913491 vs. TrEMBL
Match: Q40309_MEDSA (Chalcone reductase OS=Medicago sativa GN=CHR PE=1 SV=1) HSP 1 Score: 67.781 bits (164), Expect = 4.006e-10 Identity = 30/51 (58.82%), Postives = 41/51 (80.39%), Query Frame = 1 Query: 22 KVPEVVLSSSSGQRKMPVIGLGTAPEAIRKVTTKDAVLEAIKQGYRHFDAA 174 ++P VL+++S Q KMPV+G+G+AP+ K TKDA++EAIKQGYRHFD A Sbjct: 5 EIPTKVLTNTSSQLKMPVVGMGSAPDFTCKKDTKDAIIEAIKQGYRHFDTA 55
BLAST of GR913491 vs. TrEMBL
Match: B7FKC8_MEDTR (Putative uncharacterized protein OS=Medicago truncatula PE=2 SV=1) HSP 1 Score: 67.781 bits (164), Expect = 4.006e-10 Identity = 30/51 (58.82%), Postives = 41/51 (80.39%), Query Frame = 1 Query: 22 KVPEVVLSSSSGQRKMPVIGLGTAPEAIRKVTTKDAVLEAIKQGYRHFDAA 174 ++P VL+++S Q KMPV+G+G+AP+ K TKDA++EAIKQGYRHFD A Sbjct: 5 EIPTKVLTNTSSQLKMPVVGMGSAPDFTCKKDTKDAIIEAIKQGYRHFDTA 55 The following BLAST results are available for this feature:
BLAST of GR913491 vs. SwissProt
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Swissprot) Total hits: 1
BLAST of GR913491 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 10
InterPro
Analysis Name: InterProScan analysis for Cicer arietinum unigene v1
Date Performed: 2010-12-29
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >GR913491 ID=GR913491; Name=GR913491; organism=Cicer arietinum; type=EST; length=174bpback to top Annotated Terms
The
following terms have been associated with
this EST:
|